(data stored in ACNUC7421 zone)

EMBL: CP001349.PE254

CP001349.PE254       Location/Qualifiers
FT   CDS             292907..293860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0262"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: met:M446_2347 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55306"
FT                   /db_xref="GOA:B8I9Q3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9Q3"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ACL55306.1"
FT                   /translation="MTSLTNSLNPAQTLAPASNGDVADFFALLKPRVMALVVFTALVGM
FT                   TVSPSHVNPVIGAVSLLMIAVGAGASGCLNMWWDADIDAVMTRTRSRPIPAGRIRPEEA
FT                   LTFGLVLAVGSVLMLGLAANWLAAGLLAFTIVFYTVIYSMWLKRATAQNIVIGGAAGAL
FT                   PPMIGQAVVTGSVGIEGIILFLIIFIWTPPHFWALALVKSADYAKAGIPMMPNVAGPDS
FT                   TRRQIVGYTLLLAPLGLAPVALGFGGLIYGLVALLGGLAMLVLSLQVHRRREGESADKA
FT                   AMSLFGFSILYLFLLFSALLAEQGLGLMRPIPVLLG"
     MTSLTNSLNP AQTLAPASNG DVADFFALLK PRVMALVVFT ALVGMTVSPS HVNPVIGAVS        60
     LLMIAVGAGA SGCLNMWWDA DIDAVMTRTR SRPIPAGRIR PEEALTFGLV LAVGSVLMLG       120
     LAANWLAAGL LAFTIVFYTV IYSMWLKRAT AQNIVIGGAA GALPPMIGQA VVTGSVGIEG       180
     IILFLIIFIW TPPHFWALAL VKSADYAKAG IPMMPNVAGP DSTRRQIVGY TLLLAPLGLA       240
     PVALGFGGLI YGLVALLGGL AMLVLSLQVH RRREGESADK AAMSLFGFSI LYLFLLFSAL       300
     LAEQGLGLMR PIPVLLG                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page