(data stored in ACNUC7421 zone)

EMBL: CP001349.PE255

CP001349.PE255       Location/Qualifiers
FT   CDS             293857..294009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0263"
FT                   /product="protein CoxF"
FT                   /note="KEGG: met:M446_2346 protein CoxF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55307"
FT                   /db_xref="GOA:B8I9Q4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q4"
FT                   /inference="similar to AA sequence:KEGG:M446_2346"
FT                   /protein_id="ACL55307.1"
FT                   /translation="MTDLPTLTPEEVRRRRKRSIAIALTLTALVAIFYVLTIAKLGPQV
FT                   LNRPL"
     MTDLPTLTPE EVRRRRKRSI AIALTLTALV AIFYVLTIAK LGPQVLNRPL                   50
//

If you have problems or comments...

PBIL Back to PBIL home page