(data stored in ACNUC7421 zone)

EMBL: CP001349.PE256

CP001349.PE256       Location/Qualifiers
FT   CDS             294026..294637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0264"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: met:M446_2345 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55308"
FT                   /db_xref="GOA:B8I9Q5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q5"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ACL55308.1"
FT                   /translation="MTLPRPHAGTAGRNGIRTTLLACVGVVVGMTALAYASVPLYDLFC
FT                   KATGYDGTPLVGRGPSATVSDATMTVHFDTNVSPSLPWRFQAEAPRVEAKLGETQTVFF
FT                   RVTNTASVPTTGVATFNVQPGLMGGYFVKIQCFCFNEQTLQPGETIDVPVVFYVDPAVR
FT                   TDSNTRDYTEMTLSYTYFPSRNGQPTAALATTGAGNPRPN"
     MTLPRPHAGT AGRNGIRTTL LACVGVVVGM TALAYASVPL YDLFCKATGY DGTPLVGRGP        60
     SATVSDATMT VHFDTNVSPS LPWRFQAEAP RVEAKLGETQ TVFFRVTNTA SVPTTGVATF       120
     NVQPGLMGGY FVKIQCFCFN EQTLQPGETI DVPVVFYVDP AVRTDSNTRD YTEMTLSYTY       180
     FPSRNGQPTA ALATTGAGNP RPN                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page