(data stored in ACNUC7421 zone)

EMBL: CP001349.PE257

CP001349.PE257       Location/Qualifiers
FT   CDS             294798..295664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0265"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   met:M446_2344 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55309"
FT                   /db_xref="GOA:B8I9Q6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q6"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ACL55309.1"
FT                   /translation="MAEAHAKHHDYHLVNPSPWPLIGSLSALMTTSGAVFWMKSLTLAK
FT                   LAIGPYLFFAGVIGVLYTMLSWWRDVVHEANTGDHTRVVQLHHRYGMMMFIASEVMFFV
FT                   AWFWAYFDAALYAAEPIQASRLEFTGGTWPPKGVEAFDPWHLPLLNTLILLTSGTTITW
FT                   AHHALLNNDRKGLKYGLWLTIILGVLFSCVQGYEYAHAHFGFSGSIYSATFFMATGFHG
FT                   AHVIIGTIFLSVCLYRAYLGHFTPRQHLGFEFAAWYWHFVDVVWLFLFSAIYVWGSGFG
FT                   HAAAAGS"
     MAEAHAKHHD YHLVNPSPWP LIGSLSALMT TSGAVFWMKS LTLAKLAIGP YLFFAGVIGV        60
     LYTMLSWWRD VVHEANTGDH TRVVQLHHRY GMMMFIASEV MFFVAWFWAY FDAALYAAEP       120
     IQASRLEFTG GTWPPKGVEA FDPWHLPLLN TLILLTSGTT ITWAHHALLN NDRKGLKYGL       180
     WLTIILGVLF SCVQGYEYAH AHFGFSGSIY SATFFMATGF HGAHVIIGTI FLSVCLYRAY       240
     LGHFTPRQHL GFEFAAWYWH FVDVVWLFLF SAIYVWGSGF GHAAAAGS                    288
//

If you have problems or comments...

PBIL Back to PBIL home page