(data stored in ACNUC7421 zone)

EMBL: CP001349.PE258

CP001349.PE258       Location/Qualifiers
FT   CDS             295949..296317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0266"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983; KEGG:
FT                   met:M446_2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55310"
FT                   /db_xref="GOA:B8I9Q7"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q7"
FT                   /inference="protein motif:PFAM:PF06170"
FT                   /protein_id="ACL55310.1"
FT                   /translation="MDDIRATSSPATAGLRGRCPRCGEGHLFKGFLSFRPRCEVCGLDF
FT                   KFIDSADGPAFFVMSIVGLIVVALAMWVEFAYEPPLWVHAVLWAPLAIVLSLVLVRPLK
FT                   GLMAALQFSNRAEQGRFR"
     MDDIRATSSP ATAGLRGRCP RCGEGHLFKG FLSFRPRCEV CGLDFKFIDS ADGPAFFVMS        60
     IVGLIVVALA MWVEFAYEPP LWVHAVLWAP LAIVLSLVLV RPLKGLMAAL QFSNRAEQGR       120
     FR                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page