(data stored in ACNUC7421 zone)

EMBL: CP001349.PE259

CP001349.PE259       Location/Qualifiers
FT   CDS             296317..297078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0267"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   met:M446_2342 surfeit locus 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55311"
FT                   /db_xref="GOA:B8I9Q8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q8"
FT                   /inference="protein motif:PFAM:PF02104"
FT                   /protein_id="ACL55311.1"
FT                   /translation="MDAAAEPVRRSPPWRDLLAPGLATLVCLAILLALGTWQLQRKAWK
FT                   EGVIRQVVERSRIDPPLAPPAAGTWDPAADEFKRVRITGRLLNDRETLVHGLAPGEAPG
FT                   RALQGYYVLTPLVREDGPPILINRGFVPTELRNPRDRAAGEVAGPVTVTGILRASEERG
FT                   LFVPAPDPQRGEWFNRDIPGIAAARGLTEVAPYLIEADATPNPGGWPRGGQLRVDLPNN
FT                   HLQYAFTWYGIALCLVGVFSAYAWKRLREVA"
     MDAAAEPVRR SPPWRDLLAP GLATLVCLAI LLALGTWQLQ RKAWKEGVIR QVVERSRIDP        60
     PLAPPAAGTW DPAADEFKRV RITGRLLNDR ETLVHGLAPG EAPGRALQGY YVLTPLVRED       120
     GPPILINRGF VPTELRNPRD RAAGEVAGPV TVTGILRASE ERGLFVPAPD PQRGEWFNRD       180
     IPGIAAARGL TEVAPYLIEA DATPNPGGWP RGGQLRVDLP NNHLQYAFTW YGIALCLVGV       240
     FSAYAWKRLR EVA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page