(data stored in ACNUC7421 zone)

EMBL: CP001349.PE26

CP001349.PE26        Location/Qualifiers
FT   CDS             complement(27573..28736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0027"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: met:M446_0024 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55078"
FT                   /db_xref="GOA:B8IT16"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT16"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACL55078.1"
FT                   /translation="MIDHPTRDVGFGVYLHWPFCAAKCPYCDFNSHVRHAPPDEAVWRA
FT                   AFAREIAHVSALTPGRTVTSIFFGGGTPSLMQPATVGALLDAVAGAWSLSPDAEITLEA
FT                   NPTSVEAERFRGYRLAGVNRVSLGVQALDDASLKRLGRLHSAAEALAAVATAARHFERY
FT                   SFDLIYARPDQTQAAWAAELREAIARAAEHLSLYQLTIEEGTPFHGLAAAGKLVTPDED
FT                   AARALFDVTQEVCAAAGLPAYEISNHARPGAESRHNLLYWRYGEYAGIGPGAHGRLVLP
FT                   EGRTGTVTERVPEAWLARVARDGHGIVTMEPLKPAEEADEFLLMGLRLAEGIDPARFAA
FT                   LAGRPIDRGRLDALVQEGLIALTGSGRIAATPKGAPVLNALVAELAA"
     MIDHPTRDVG FGVYLHWPFC AAKCPYCDFN SHVRHAPPDE AVWRAAFARE IAHVSALTPG        60
     RTVTSIFFGG GTPSLMQPAT VGALLDAVAG AWSLSPDAEI TLEANPTSVE AERFRGYRLA       120
     GVNRVSLGVQ ALDDASLKRL GRLHSAAEAL AAVATAARHF ERYSFDLIYA RPDQTQAAWA       180
     AELREAIARA AEHLSLYQLT IEEGTPFHGL AAAGKLVTPD EDAARALFDV TQEVCAAAGL       240
     PAYEISNHAR PGAESRHNLL YWRYGEYAGI GPGAHGRLVL PEGRTGTVTE RVPEAWLARV       300
     ARDGHGIVTM EPLKPAEEAD EFLLMGLRLA EGIDPARFAA LAGRPIDRGR LDALVQEGLI       360
     ALTGSGRIAA TPKGAPVLNA LVAELAA                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page