(data stored in ACNUC7421 zone)

EMBL: CP001349.PE260

CP001349.PE260       Location/Qualifiers
FT   CDS             297415..298830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0268"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: met:M446_2341 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55312"
FT                   /db_xref="GOA:B8I9Q9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q9"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACL55312.1"
FT                   /translation="MLHVSTRGAAAKLTFTDALLAGLARDGGLYLPERWPALDPAAIAG
FT                   LAGRPYAAAAKTVLSPLVDGEIPQGDLDRMIEGAYATFRHPAVCPLVQLGDNLFLLELH
FT                   HGPTLAFKDVAMQLLGRLMDHVLKARGSRATIVGATSGDTGSAAVEAFRGLDQVDVFIL
FT                   FPHGRVSEVQRRQMTTVDSANVHAVAVEGTFDDCQAIVKALFQHPRFAEEVRLSGVNSI
FT                   NWARVAAQAVYYFTSAVALGSPHRPVSFSVPTGNFGDILAGWVAKRMGLPVGRLMIATN
FT                   ANDILARTLASGAYEVRGVAPTTSPSMDIQVSSNFERLLFEALDREPEGLNRLMASLKQ
FT                   SGAFSLPPAVLERVRAEFDAAAVQEPEVAAEIRETYRSTGYVLDPHSAIGVRAGRRLLD
FT                   ADPATPVVALATAHAAKFPDAVEAATGQRPALPPHLADLMTRRERFAVLPNDEGAVERF
FT                   IRERARILRGAAA"
     MLHVSTRGAA AKLTFTDALL AGLARDGGLY LPERWPALDP AAIAGLAGRP YAAAAKTVLS        60
     PLVDGEIPQG DLDRMIEGAY ATFRHPAVCP LVQLGDNLFL LELHHGPTLA FKDVAMQLLG       120
     RLMDHVLKAR GSRATIVGAT SGDTGSAAVE AFRGLDQVDV FILFPHGRVS EVQRRQMTTV       180
     DSANVHAVAV EGTFDDCQAI VKALFQHPRF AEEVRLSGVN SINWARVAAQ AVYYFTSAVA       240
     LGSPHRPVSF SVPTGNFGDI LAGWVAKRMG LPVGRLMIAT NANDILARTL ASGAYEVRGV       300
     APTTSPSMDI QVSSNFERLL FEALDREPEG LNRLMASLKQ SGAFSLPPAV LERVRAEFDA       360
     AAVQEPEVAA EIRETYRSTG YVLDPHSAIG VRAGRRLLDA DPATPVVALA TAHAAKFPDA       420
     VEAATGQRPA LPPHLADLMT RRERFAVLPN DEGAVERFIR ERARILRGAA A                471
//

If you have problems or comments...

PBIL Back to PBIL home page