(data stored in ACNUC7421 zone)

EMBL: CP001349.PE261

CP001349.PE261       Location/Qualifiers
FT   CDS             298827..300122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0269"
FT                   /product="peptidase M16 domain protein"
FT                   /EC_number="3.4.24.64"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2340 processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55313"
FT                   /db_xref="GOA:B8I9R0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R0"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55313.1"
FT                   /translation="MNEHFATFGASPSLRITRLPNGLTVATEPMPGVATATLGVWVGAG
FT                   SRHERPQEHGLSHLIEHMAFKGTCRRSARAIAEDIENVGGDINAATSAEQTSYTARVLG
FT                   EDIGVALDVIGDILTNSVFDAGELAREKGVILQEYAAVEDTPDDVVYDAFTEAAFPDQP
FT                   IGRPILGRPETIQSFDRRAIEVYLAREYTPDRMVLAAAGAVEHEAIVEAAERHFGALPA
FT                   RTAPDAEAGLYLGGERRMLRKLEQANLVLGLPGLSFRDEGYYALHLFAQVLGGGLTSRL
FT                   WHEVRETRGLAYEIHAFHWPFSDCGLFGIGAGTAGADLPALVEVTVACLGNAAASIEET
FT                   ELARAKAQLKVSLLSALETPGGRIERIARQILAWGRVIPAEEIIAKVDAVTPEQVRAAG
FT                   RAVMAGAPTLAAIGPIRKLPSLDAVGNALKAA"
     MNEHFATFGA SPSLRITRLP NGLTVATEPM PGVATATLGV WVGAGSRHER PQEHGLSHLI        60
     EHMAFKGTCR RSARAIAEDI ENVGGDINAA TSAEQTSYTA RVLGEDIGVA LDVIGDILTN       120
     SVFDAGELAR EKGVILQEYA AVEDTPDDVV YDAFTEAAFP DQPIGRPILG RPETIQSFDR       180
     RAIEVYLARE YTPDRMVLAA AGAVEHEAIV EAAERHFGAL PARTAPDAEA GLYLGGERRM       240
     LRKLEQANLV LGLPGLSFRD EGYYALHLFA QVLGGGLTSR LWHEVRETRG LAYEIHAFHW       300
     PFSDCGLFGI GAGTAGADLP ALVEVTVACL GNAAASIEET ELARAKAQLK VSLLSALETP       360
     GGRIERIARQ ILAWGRVIPA EEIIAKVDAV TPEQVRAAGR AVMAGAPTLA AIGPIRKLPS       420
     LDAVGNALKA A                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page