(data stored in ACNUC7421 zone)

EMBL: CP001349.PE262

CP001349.PE262       Location/Qualifiers
FT   CDS             300357..303236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0270"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC-like protein"
FT                   /note="KEGG: met:M446_2339 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Diverse 7TM
FT                   receptor extracellular region 2; Diverse 7TM receptor
FT                   transmembrane region; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55314"
FT                   /db_xref="GOA:B8I9R1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55314.1"
FT                   /translation="MRHASLALALLVALAGALLPSAARALEAVRVGLDAQAIDLTPAIE
FT                   RYRSDGDLIQISTAPGKDGIVRRIAVKARETGARPDWIVFALTNDTDEQIDRLLVAPHF
FT                   RLVGSGIIWPDLGGSRIAAITASQGIRPERDESPDADQFTVTLDPGTTVTFVAELRTPN
FT                   VPQLYLWDQDAYRKKATGLTLYKGIIIGIAGLLALFLTVVFVVKGAIIFPAAAALAWSV
FT                   LAYTCIDFGFFQRIFPVTEAAERVYRASAEAVLGATLLVFLFAYLNLARWHVRYSHVAL
FT                   LWLIFLAGLVALAVVDPPVAAGVARISIATVAGVGLLLVVYLAAHNGYDRAILLIPTWL
FT                   LLTAWVVAAGFAITGQLRNDLVQPALIGGLVLIVMLIGFTVLQHAFAGGGIGTAVVSDT
FT                   ERRALALTGAGDVVFDWDVPGDRVFAGPEIESQLGLKRGALEGPAANWLALLHPFDVDR
FT                   YSAALDTVIEERRGRICQDFRLRAAAGPYYWFRLKARPVIGADGEVIRIVGTIADVTEV
FT                   KIAEERLLHDAVHDNLTGLPNRELFNDRLDAALTLAAQDPRLKPTVFVLDIDRFKQVND
FT                   AIGLSAGDSILLTLSRRLGRLLRPQDTLARIAGDELAVILVSERDPDRIIAFADMIRRA
FT                   ITTPITYADREIFLTPSIGVVLHEAGSNPKRDQIFKNAEIAMIQAKRQGGDRIEVYRPT
FT                   MRSDRGDRLMLESDLRQALERNEIKVLFQPIVRLEDRTVAGFEALLRWDHPKHGRIPPQ
FT                   TFIPIAEESGLIVDLGVFALERTAAELAAWQQALVVEPPLFASVNVSSRQLLRHDLLHD
FT                   VKTVLARTGVAPGSLKLELTESLVMENPEYAAQMLARIAELGAGLSLDDFGTGYSALAY
FT                   LQRFPFDTIKIDQSFVRQMANGRSVILRSIVRMAQELGLEIVAEGAETEADARALAEIG
FT                   CDYAQGFAFGEPMSVHQARQLVGAAPAAA"
     MRHASLALAL LVALAGALLP SAARALEAVR VGLDAQAIDL TPAIERYRSD GDLIQISTAP        60
     GKDGIVRRIA VKARETGARP DWIVFALTND TDEQIDRLLV APHFRLVGSG IIWPDLGGSR       120
     IAAITASQGI RPERDESPDA DQFTVTLDPG TTVTFVAELR TPNVPQLYLW DQDAYRKKAT       180
     GLTLYKGIII GIAGLLALFL TVVFVVKGAI IFPAAAALAW SVLAYTCIDF GFFQRIFPVT       240
     EAAERVYRAS AEAVLGATLL VFLFAYLNLA RWHVRYSHVA LLWLIFLAGL VALAVVDPPV       300
     AAGVARISIA TVAGVGLLLV VYLAAHNGYD RAILLIPTWL LLTAWVVAAG FAITGQLRND       360
     LVQPALIGGL VLIVMLIGFT VLQHAFAGGG IGTAVVSDTE RRALALTGAG DVVFDWDVPG       420
     DRVFAGPEIE SQLGLKRGAL EGPAANWLAL LHPFDVDRYS AALDTVIEER RGRICQDFRL       480
     RAAAGPYYWF RLKARPVIGA DGEVIRIVGT IADVTEVKIA EERLLHDAVH DNLTGLPNRE       540
     LFNDRLDAAL TLAAQDPRLK PTVFVLDIDR FKQVNDAIGL SAGDSILLTL SRRLGRLLRP       600
     QDTLARIAGD ELAVILVSER DPDRIIAFAD MIRRAITTPI TYADREIFLT PSIGVVLHEA       660
     GSNPKRDQIF KNAEIAMIQA KRQGGDRIEV YRPTMRSDRG DRLMLESDLR QALERNEIKV       720
     LFQPIVRLED RTVAGFEALL RWDHPKHGRI PPQTFIPIAE ESGLIVDLGV FALERTAAEL       780
     AAWQQALVVE PPLFASVNVS SRQLLRHDLL HDVKTVLART GVAPGSLKLE LTESLVMENP       840
     EYAAQMLARI AELGAGLSLD DFGTGYSALA YLQRFPFDTI KIDQSFVRQM ANGRSVILRS       900
     IVRMAQELGL EIVAEGAETE ADARALAEIG CDYAQGFAFG EPMSVHQARQ LVGAAPAAA        959
//

If you have problems or comments...

PBIL Back to PBIL home page