(data stored in ACNUC7421 zone)

EMBL: CP001349.PE263

CP001349.PE263       Location/Qualifiers
FT   CDS             complement(303441..304421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0271"
FT                   /product="transposase IS111A/IS1328/IS1533"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: gdi:GDI1409
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55315"
FT                   /db_xref="GOA:B8I9R2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R2"
FT                   /inference="protein motif:PFAM:PF01548"
FT                   /protein_id="ACL55315.1"
FT                   /translation="MQGKEVSKQETAGKSSVGIDVSKSWLDVHVLPSGQAQRFANTEVG
FT                   IRQLKRWLGRFALGLVVVEATGKWHRQTRRSLHASGLPVAVVDPFRVRMFAKAQGIWAK
FT                   TDRLDARVLAQFAAVMAPPQRPPASDALEALQELVAARDSAVAEQTALKNQLAAAASPF
FT                   LIRQFQDRLARIAADIEALAGEIRRLIAADPGLARRHAILVSIPSIGDTIAATLVASLA
FT                   ELGTCSSRQIGLLAGLAPVADDSGARQGVRVIWGGRPPVRRVLYLAALSAARHNAGLKA
FT                   FHERLIANGKKPKCAIIAVARKLAVLANSLIAQDRLWTPNQPQQA"
     MQGKEVSKQE TAGKSSVGID VSKSWLDVHV LPSGQAQRFA NTEVGIRQLK RWLGRFALGL        60
     VVVEATGKWH RQTRRSLHAS GLPVAVVDPF RVRMFAKAQG IWAKTDRLDA RVLAQFAAVM       120
     APPQRPPASD ALEALQELVA ARDSAVAEQT ALKNQLAAAA SPFLIRQFQD RLARIAADIE       180
     ALAGEIRRLI AADPGLARRH AILVSIPSIG DTIAATLVAS LAELGTCSSR QIGLLAGLAP       240
     VADDSGARQG VRVIWGGRPP VRRVLYLAAL SAARHNAGLK AFHERLIANG KKPKCAIIAV       300
     ARKLAVLANS LIAQDRLWTP NQPQQA                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page