(data stored in ACNUC7421 zone)

EMBL: CP001349.PE264

CP001349.PE264       Location/Qualifiers
FT   CDS             complement(304972..305358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0272"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_2338 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55316"
FT                   /db_xref="GOA:B8I9R3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R3"
FT                   /inference="similar to AA sequence:KEGG:M446_2338"
FT                   /protein_id="ACL55316.1"
FT                   /translation="MLTGRRILIVEDEMLIALELSDVVADAQGCPIGPVRSNREALVLL
FT                   DREPVDVAILDLNLADGEATPTAERLIGSGIPVLVCTGGVLPRAMRLMWPDLPVHRKPV
FT                   SADRLIRTLEALCGAPQAAGDAHA"
     MLTGRRILIV EDEMLIALEL SDVVADAQGC PIGPVRSNRE ALVLLDREPV DVAILDLNLA        60
     DGEATPTAER LIGSGIPVLV CTGGVLPRAM RLMWPDLPVH RKPVSADRLI RTLEALCGAP       120
     QAAGDAHA                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page