(data stored in ACNUC7421 zone)

EMBL: CP001349.PE266

CP001349.PE266       Location/Qualifiers
FT   CDS             305998..306963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0274"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: met:M446_2336 oxidoreductase
FT                   FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55318"
FT                   /db_xref="GOA:B8I9R5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R5"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACL55318.1"
FT                   /translation="MASRPRCSLVLNGKTVRVATGDTPLEAALTAGVAAGHDGIVQDAI
FT                   PRLPKTSRTRPRLGDGATRQGPAPSPLAALRAAKRAGTVLSVTPLSDAVREVVVTVSRP
FT                   LDIQPGQAMEVAFSGFPARPLCPTQRLDGATELNELVFHLRRDTHLGSALGEAVGPGHA
FT                   VRLRGPVGPASYRPGTGRLVLVSAETGFAPIWAIARAARHLEPEREMVLIAGARDAADL
FT                   YMRPALAWLRGTGVTRITLVAAVNRIGVPDVRPGPIAAHLPPLLTSDCVHAAGAPDVVR
FT                   AVERLAAEAGASCAAIPFLPQLSRARSLVTPGEPDATHRR"
     MASRPRCSLV LNGKTVRVAT GDTPLEAALT AGVAAGHDGI VQDAIPRLPK TSRTRPRLGD        60
     GATRQGPAPS PLAALRAAKR AGTVLSVTPL SDAVREVVVT VSRPLDIQPG QAMEVAFSGF       120
     PARPLCPTQR LDGATELNEL VFHLRRDTHL GSALGEAVGP GHAVRLRGPV GPASYRPGTG       180
     RLVLVSAETG FAPIWAIARA ARHLEPEREM VLIAGARDAA DLYMRPALAW LRGTGVTRIT       240
     LVAAVNRIGV PDVRPGPIAA HLPPLLTSDC VHAAGAPDVV RAVERLAAEA GASCAAIPFL       300
     PQLSRARSLV TPGEPDATHR R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page