(data stored in ACNUC7421 zone)

EMBL: CP001349.PE267

CP001349.PE267       Location/Qualifiers
FT   CDS             307042..309747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0275"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /note="KEGG: met:M446_2335 ABC-type multidrug transport
FT                   system ATPase and permease components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55319"
FT                   /db_xref="GOA:B8I9R6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R6"
FT                   /inference="similar to AA sequence:KEGG:M446_2335"
FT                   /protein_id="ACL55319.1"
FT                   /translation="MERDPIAFAWRSAPRQHTAAIAVAVGLGTPVVALGLALMRDLVDE
FT                   LLAVADPAGPLLLLLRVSLPLPERLGGTITLLPGWPVDAAEMTLWAVGGLAAVALALAA
FT                   LGWLTARLCFAAQGAAIERLRHRAAEAILRSGPAGREEARALGHQVGEALRAVDALLAV
FT                   GLLVPALTAGAVLLALLVAAAAAPRLVPAVAVSVVAAALARALLNIRANRQSEQRREES
FT                   SALERALADLVRRLPAVRAHGTAAFERARLGHAAHSARRGLARAEASLARARAPALALF
FT                   VLLPAIVLATALWQGEGPPRPVTAGALAAAFGALALAASLLALFLRQTERRRAALPAFR
FT                   EISRIVASLEARARAVRRHGPAARFPASGAVALAGVAAYDPASGERLTGLDLVLPMPSH
FT                   VAILGGRGSGGRVLAALIAGQLEPTVGRVTYAGIDLRALDSSERARRIAFAGDEPVLMA
FT                   GSLLQNLLYGDLAFVDGSAPDPEAPAAHAPHLEERLVEALAVTGLDALVTARGLASLVS
FT                   RTIDPATAAAIVETRGALRAALAAENAAHLIEPFDPHRYNAQATVGENILFGKPVGSAF
FT                   SEGRLASHPFTRAVLEAEGLTRPMIEMGLSIARATVEIFSDLPDDHPLFDAFSLFPAAE
FT                   RGFFEDLVARQPEATGWRRGPAGQRDRARLIGLALRYSETRHRFGLIDAAFEERLVAAR
FT                   HTFAALLPASLRPAVEFYDPGKVTVAASLEENLLFGRIAGAEAGAGTRVRAVMQRVLAE
FT                   RGLERTVFRLGLSARVDPRAAESSLGARDGVLTPAERSAIDLARCLVRQPDILVVGLAL
FT                   DERSPGEIRAGLARLRAARAGRGLVVCLPDEASLSPDAPFDAVIRAERNTALLLAPSGP
FT                   PNESTLLRRAADPGNFADETAVRDGVTAWR"
     MERDPIAFAW RSAPRQHTAA IAVAVGLGTP VVALGLALMR DLVDELLAVA DPAGPLLLLL        60
     RVSLPLPERL GGTITLLPGW PVDAAEMTLW AVGGLAAVAL ALAALGWLTA RLCFAAQGAA       120
     IERLRHRAAE AILRSGPAGR EEARALGHQV GEALRAVDAL LAVGLLVPAL TAGAVLLALL       180
     VAAAAAPRLV PAVAVSVVAA ALARALLNIR ANRQSEQRRE ESSALERALA DLVRRLPAVR       240
     AHGTAAFERA RLGHAAHSAR RGLARAEASL ARARAPALAL FVLLPAIVLA TALWQGEGPP       300
     RPVTAGALAA AFGALALAAS LLALFLRQTE RRRAALPAFR EISRIVASLE ARARAVRRHG       360
     PAARFPASGA VALAGVAAYD PASGERLTGL DLVLPMPSHV AILGGRGSGG RVLAALIAGQ       420
     LEPTVGRVTY AGIDLRALDS SERARRIAFA GDEPVLMAGS LLQNLLYGDL AFVDGSAPDP       480
     EAPAAHAPHL EERLVEALAV TGLDALVTAR GLASLVSRTI DPATAAAIVE TRGALRAALA       540
     AENAAHLIEP FDPHRYNAQA TVGENILFGK PVGSAFSEGR LASHPFTRAV LEAEGLTRPM       600
     IEMGLSIARA TVEIFSDLPD DHPLFDAFSL FPAAERGFFE DLVARQPEAT GWRRGPAGQR       660
     DRARLIGLAL RYSETRHRFG LIDAAFEERL VAARHTFAAL LPASLRPAVE FYDPGKVTVA       720
     ASLEENLLFG RIAGAEAGAG TRVRAVMQRV LAERGLERTV FRLGLSARVD PRAAESSLGA       780
     RDGVLTPAER SAIDLARCLV RQPDILVVGL ALDERSPGEI RAGLARLRAA RAGRGLVVCL       840
     PDEASLSPDA PFDAVIRAER NTALLLAPSG PPNESTLLRR AADPGNFADE TAVRDGVTAW       900
     R                                                                       901
//

If you have problems or comments...

PBIL Back to PBIL home page