(data stored in ACNUC7421 zone)

EMBL: CP001349.PE268

CP001349.PE268       Location/Qualifiers
FT   CDS             309848..310774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0276"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: met:M446_2334 beta-lactamase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55320"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R7"
FT                   /inference="similar to AA sequence:KEGG:M446_2334"
FT                   /protein_id="ACL55320.1"
FT                   /translation="MRSRTFFCDEADHHPRMTQEGLTAPGDLTLRFWGVRGSICASGPN
FT                   FVEFGGHTPCVEIRCGERLFVIDAGTGLNALGAHHGADLPQRIDLLFSHLHLDHVTGLA
FT                   FLKPAVLDKNREIHTYCGNLDGQSAEEPLNRLFSPPLFPITLDALPARFVHHGFRAGET
FT                   LTFPDGMEVDTLPLQHPQGATGYRFRHAGRTACYISDIEHSEPWPERNLLHFVEGADLI
FT                   LYDGMFTEGEYPSCRGWGHSTWEKGVELCRAAKVGRLGIIHLYPQHGDAMLRDMEQAMQ
FT                   AAMPTAFICRERQKIVLPAEVRVPELA"
     MRSRTFFCDE ADHHPRMTQE GLTAPGDLTL RFWGVRGSIC ASGPNFVEFG GHTPCVEIRC        60
     GERLFVIDAG TGLNALGAHH GADLPQRIDL LFSHLHLDHV TGLAFLKPAV LDKNREIHTY       120
     CGNLDGQSAE EPLNRLFSPP LFPITLDALP ARFVHHGFRA GETLTFPDGM EVDTLPLQHP       180
     QGATGYRFRH AGRTACYISD IEHSEPWPER NLLHFVEGAD LILYDGMFTE GEYPSCRGWG       240
     HSTWEKGVEL CRAAKVGRLG IIHLYPQHGD AMLRDMEQAM QAAMPTAFIC RERQKIVLPA       300
     EVRVPELA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page