(data stored in ACNUC7421 zone)

EMBL: CP001349.PE269

CP001349.PE269       Location/Qualifiers
FT   CDS             complement(310905..311918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0277"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   met:M446_2333 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55321"
FT                   /db_xref="GOA:B8I9R8"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R8"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACL55321.1"
FT                   /translation="MLVRSASLPLVPARGAILRVGLALAAVAAAAFLLAGLVALLAPGF
FT                   APPPRSPFGMGFREAAPSGAGSLGAWLLAMQAAFSRSLQAAVSAVRTGQGGYGLLAGLG
FT                   FAYGIFHAAGPGHGKAVIAGYIVAGERALARGVTLSAAAALLQAMVALALVGGGAALLR
FT                   LTAAGLTEAGRWIETAGFACVALLGLAVTWRKAGALAARLQGGSAAPCGPECGHAVLAD
FT                   ARRIERLGTWREQAGVVIAAGTRPCAGAILVLVFALSQGVFLAGVLATLAMALGTALTT
FT                   SALAALAVFAKALALRLAGGRGEAGAVAVGTLELLAAAFVLVLGTALLAGYAAAIV"
     MLVRSASLPL VPARGAILRV GLALAAVAAA AFLLAGLVAL LAPGFAPPPR SPFGMGFREA        60
     APSGAGSLGA WLLAMQAAFS RSLQAAVSAV RTGQGGYGLL AGLGFAYGIF HAAGPGHGKA       120
     VIAGYIVAGE RALARGVTLS AAAALLQAMV ALALVGGGAA LLRLTAAGLT EAGRWIETAG       180
     FACVALLGLA VTWRKAGALA ARLQGGSAAP CGPECGHAVL ADARRIERLG TWREQAGVVI       240
     AAGTRPCAGA ILVLVFALSQ GVFLAGVLAT LAMALGTALT TSALAALAVF AKALALRLAG       300
     GRGEAGAVAV GTLELLAAAF VLVLGTALLA GYAAAIV                                337
//

If you have problems or comments...

PBIL Back to PBIL home page