(data stored in ACNUC7421 zone)

EMBL: CP001349.PE27

CP001349.PE27        Location/Qualifiers
FT   CDS             complement(29036..29338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0028"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   met:M446_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55079"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT17"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACL55079.1"
FT                   /translation="MSAPPAFACQACGACCAYSADWPRFSTEDEAALAAIPAAYVDDPA
FT                   GRMRCEGDRCSALAGEVGVAVTCRVYAVRPEVCRTCEPGDPECLTARRRFGLPVP"
     MSAPPAFACQ ACGACCAYSA DWPRFSTEDE AALAAIPAAY VDDPAGRMRC EGDRCSALAG        60
     EVGVAVTCRV YAVRPEVCRT CEPGDPECLT ARRRFGLPVP                             100
//

If you have problems or comments...

PBIL Back to PBIL home page