(data stored in ACNUC7421 zone)

EMBL: CP001349.PE270

CP001349.PE270       Location/Qualifiers
FT   CDS             complement(311909..312553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0278"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="PFAM: protein of unknown function DUF1007; KEGG:
FT                   met:M446_2332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55322"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R9"
FT                   /inference="protein motif:PFAM:PF06226"
FT                   /protein_id="ACL55322.1"
FT                   /translation="MPGVTKPIRLRVPALAGVLLAASLSAAHAHPHVWVTTRAEFVFAP
FT                   DGRVTAIRHAWTFDPSYSAFTVQGLGQGIPNAEALAALARDNVEALGDSGYFTSLKVDG
FT                   RRQDFSGPEAPAMTYADGQLTLHFTLPLKAPARGALALEVYDPTYFVAFSLAEGDAVAA
FT                   LKGAPSGCKAVAHRPKSAPPQTGMSESFFAALTDAANYGVQFANRIIVSCS"
     MPGVTKPIRL RVPALAGVLL AASLSAAHAH PHVWVTTRAE FVFAPDGRVT AIRHAWTFDP        60
     SYSAFTVQGL GQGIPNAEAL AALARDNVEA LGDSGYFTSL KVDGRRQDFS GPEAPAMTYA       120
     DGQLTLHFTL PLKAPARGAL ALEVYDPTYF VAFSLAEGDA VAALKGAPSG CKAVAHRPKS       180
     APPQTGMSES FFAALTDAAN YGVQFANRII VSCS                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page