(data stored in ACNUC7421 zone)

EMBL: CP001349.PE271

CP001349.PE271       Location/Qualifiers
FT   CDS             complement(312607..313533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0279"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2331 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55323"
FT                   /db_xref="GOA:B8I9S0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55323.1"
FT                   /translation="MGSRRLPPLNAVRAFEAAARHATFQAAGDELGVSAGAVAQQVKAL
FT                   EAWFGLPLFRRLPSRGVVLTPAGARFADAAASLLDGVAAAALALRRRSDDTALTINTTH
FT                   SFAALWLIPRIGSFREANPDLHVRIVANNQVIDFTREAADCAIRHGKGGYAGVRTELLL
FT                   RDAVFPVCSPRLRDGVPPLRRLQDLASHTLLHDDDPLDAGMIGWIGWREWLAAVGMPDL
FT                   VAKRGPTFTHTFMVLQAATAGQGVALATRVLGGDLLEPGGLVRPFAEEVPSPYSFFIVT
FT                   PDEPDPPKVAHFRAWLRAQADAPLSPQ"
     MGSRRLPPLN AVRAFEAAAR HATFQAAGDE LGVSAGAVAQ QVKALEAWFG LPLFRRLPSR        60
     GVVLTPAGAR FADAAASLLD GVAAAALALR RRSDDTALTI NTTHSFAALW LIPRIGSFRE       120
     ANPDLHVRIV ANNQVIDFTR EAADCAIRHG KGGYAGVRTE LLLRDAVFPV CSPRLRDGVP       180
     PLRRLQDLAS HTLLHDDDPL DAGMIGWIGW REWLAAVGMP DLVAKRGPTF THTFMVLQAA       240
     TAGQGVALAT RVLGGDLLEP GGLVRPFAEE VPSPYSFFIV TPDEPDPPKV AHFRAWLRAQ       300
     ADAPLSPQ                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page