(data stored in ACNUC7421 zone)

EMBL: CP001349.PE273

CP001349.PE273       Location/Qualifiers
FT   CDS             complement(313981..316041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0281"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; protein
FT                   of unknown function DUF839; KEGG: chu:CHU_3119 phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55325"
FT                   /db_xref="GOA:B8I9S2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S2"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ACL55325.1"
FT                   /translation="MAANQTGPSTTQSPYLVPTTDKVAFTSILSAGDTVAGSVKSDGTP
FT                   WRFAGIPDGIGAFDNGNGTATVLVNHELRETTGATRAHGAIGAFVDRLIIDKATLQVRS
FT                   ASDLGTSTFTFNPTTGTYVQGPTTISRLCSADLPAVSAFYDATTGLGTQTRIFMNGEES
FT                   GAEGRAFAWIVNGPEAGRVYELPRLGNFSFENSVANPGSGAKTVSIGLDDSSGGQLYVY
FT                   AGNKQATGTEIEKAGLTNGKLYGIKVPAFAAETNTTSVAAAGTAFTLQEMGPNGDVSAV
FT                   TGAQLEAESTAEGVTAFLRPEDGAWDPTNPNRFYFTTTNAITSPSRLWALDFTDVTRPE
FT                   LGGTVKMLLDGTEGQVMFDNLTVTAEGRVILQEDPGNNARLAKMWQYDPATDALTQLGE
FT                   HDPARFSGLTPPFTQDEESSGVLDVSTIFGGPGRQAFLLDTQAHYAFGSSEIVEGGQLQ
FT                   MMYVDRTINGTAGNDSLVGSQIADLIWGNDGDDTIRGAAGDDYLSGLAGNDSIDGGAGN
FT                   DTLFGDAGDDRVDGGEGDDVVRGWYGNDTLFGSGGNDAVFGEDGHDFIGAGSGNDYVSG
FT                   GAGNDALYGEAGNDLLFGNAGNDELVGGTGSDTFGFGRGDGQDLIRDFTVGGAERDVIA
FT                   FNGGAFASFAAVQAATQQVGADAVISYGAGDTIRLQNTQLASLTADNFTFA"
     MAANQTGPST TQSPYLVPTT DKVAFTSILS AGDTVAGSVK SDGTPWRFAG IPDGIGAFDN        60
     GNGTATVLVN HELRETTGAT RAHGAIGAFV DRLIIDKATL QVRSASDLGT STFTFNPTTG       120
     TYVQGPTTIS RLCSADLPAV SAFYDATTGL GTQTRIFMNG EESGAEGRAF AWIVNGPEAG       180
     RVYELPRLGN FSFENSVANP GSGAKTVSIG LDDSSGGQLY VYAGNKQATG TEIEKAGLTN       240
     GKLYGIKVPA FAAETNTTSV AAAGTAFTLQ EMGPNGDVSA VTGAQLEAES TAEGVTAFLR       300
     PEDGAWDPTN PNRFYFTTTN AITSPSRLWA LDFTDVTRPE LGGTVKMLLD GTEGQVMFDN       360
     LTVTAEGRVI LQEDPGNNAR LAKMWQYDPA TDALTQLGEH DPARFSGLTP PFTQDEESSG       420
     VLDVSTIFGG PGRQAFLLDT QAHYAFGSSE IVEGGQLQMM YVDRTINGTA GNDSLVGSQI       480
     ADLIWGNDGD DTIRGAAGDD YLSGLAGNDS IDGGAGNDTL FGDAGDDRVD GGEGDDVVRG       540
     WYGNDTLFGS GGNDAVFGED GHDFIGAGSG NDYVSGGAGN DALYGEAGND LLFGNAGNDE       600
     LVGGTGSDTF GFGRGDGQDL IRDFTVGGAE RDVIAFNGGA FASFAAVQAA TQQVGADAVI       660
     SYGAGDTIRL QNTQLASLTA DNFTFA                                            686
//

If you have problems or comments...

PBIL Back to PBIL home page