(data stored in ACNUC7421 zone)

EMBL: CP001349.PE274

CP001349.PE274       Location/Qualifiers
FT   CDS             316282..317022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0282"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bra:BRADO0942 putative N-acyl
FT                   homoserine lactone transcriptional regulator, LuxR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55326"
FT                   /db_xref="GOA:B8I9S3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S3"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACL55326.1"
FT                   /translation="MSGMEDFFLRETFALIDALDEVRDPFEAQTRIFEHIQHVGFTSFT
FT                   ITRLPRPSDRLGPNMLFNMWPKDWLTHYDRVGHYRFDPVVRQCYRTTEPFAWSEVPFDA
FT                   DQPDRARRVMDEAAAFGLGFGFCIPVHDALGFQGGVSLAGERIDLSPKIRRGLHMLGLY
FT                   AWGAATRTTEDRRRSEPGRLLSARERDVLSWAAMGRTREEIATILGVSHETVATHLKSA
FT                   RIKIGARNTTQTVVEALRKREITL"
     MSGMEDFFLR ETFALIDALD EVRDPFEAQT RIFEHIQHVG FTSFTITRLP RPSDRLGPNM        60
     LFNMWPKDWL THYDRVGHYR FDPVVRQCYR TTEPFAWSEV PFDADQPDRA RRVMDEAAAF       120
     GLGFGFCIPV HDALGFQGGV SLAGERIDLS PKIRRGLHML GLYAWGAATR TTEDRRRSEP       180
     GRLLSARERD VLSWAAMGRT REEIATILGV SHETVATHLK SARIKIGARN TTQTVVEALR       240
     KREITL                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page