(data stored in ACNUC7421 zone)

EMBL: CP001349.PE275

CP001349.PE275       Location/Qualifiers
FT   CDS             317298..317948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0283"
FT                   /product="autoinducer synthesis protein"
FT                   /note="KEGG: rpb:RPB_0417 autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55327"
FT                   /db_xref="GOA:B8I9S4"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S4"
FT                   /inference="similar to AA sequence:KEGG:RPB_0417"
FT                   /protein_id="ACL55327.1"
FT                   /translation="MIRLHAIDHSNRERYADVLRQHDRLRRRLAAAGRCWSLAAASDDS
FT                   GAVAGQGVDLVALAPCGQVAGGTRLMPTEGPTLLGDVFPHLADMRDAARGPGVWEWTHF
FT                   VVAPRFRGDGRRCHVSGVLAVGLVEHCLARGITRMNVVTETFWVPTASELGWQPRPLGL
FT                   PVERDGVSICAFTVAMTPMALRTTRALYGVADPCLWAPAHSAGRLAPRQTLHA"
     MIRLHAIDHS NRERYADVLR QHDRLRRRLA AAGRCWSLAA ASDDSGAVAG QGVDLVALAP        60
     CGQVAGGTRL MPTEGPTLLG DVFPHLADMR DAARGPGVWE WTHFVVAPRF RGDGRRCHVS       120
     GVLAVGLVEH CLARGITRMN VVTETFWVPT ASELGWQPRP LGLPVERDGV SICAFTVAMT       180
     PMALRTTRAL YGVADPCLWA PAHSAGRLAP RQTLHA                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page