(data stored in ACNUC7421 zone)

EMBL: CP001349.PE276

CP001349.PE276       Location/Qualifiers
FT   CDS             318025..318345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55328"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55328.1"
FT                   /translation="MRKRSHLTLDEQAKPPSRAGNLMAEIGERAGDDAIVVEVTDNVDL
FT                   SDAVRAELRILRAAAAAIDLQKAVGPQVERMAAVQAMIDAAWAVFAELGRGGPGADDAI
FT                   HH"
     MRKRSHLTLD EQAKPPSRAG NLMAEIGERA GDDAIVVEVT DNVDLSDAVR AELRILRAAA        60
     AAIDLQKAVG PQVERMAAVQ AMIDAAWAVF AELGRGGPGA DDAIHH                      106
//

If you have problems or comments...

PBIL Back to PBIL home page