(data stored in ACNUC7421 zone)

EMBL: CP001349.PE277

CP001349.PE277       Location/Qualifiers
FT   CDS             complement(318648..319217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0285"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: met:M446_2328 crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55329"
FT                   /db_xref="GOA:B8I9S6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S6"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACL55329.1"
FT                   /translation="MVTTEPVRILGIDPGLRRTGWGLITVTGTRLAFVSCGVLTSDGDD
FT                   DLALRLRDLHDGLSRVVAAMQPDEVAVEETFVNKDAQATLKLGHARAVALLVPALAGLP
FT                   VAEYAANLVKKTVVGAGHAEKGQIAAMVRFLLPKADPATADAADALAVAITHAQHRAAR
FT                   ARELACAAPRARPARVGRGASLRTRA"
     MVTTEPVRIL GIDPGLRRTG WGLITVTGTR LAFVSCGVLT SDGDDDLALR LRDLHDGLSR        60
     VVAAMQPDEV AVEETFVNKD AQATLKLGHA RAVALLVPAL AGLPVAEYAA NLVKKTVVGA       120
     GHAEKGQIAA MVRFLLPKAD PATADAADAL AVAITHAQHR AARARELACA APRARPARVG       180
     RGASLRTRA                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page