(data stored in ACNUC7421 zone)

EMBL: CP001349.PE278

CP001349.PE278       Location/Qualifiers
FT   CDS             complement(319388..321748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0286"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /EC_number="4.1.1.17"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   mrd:Mrad2831_4404 ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55330"
FT                   /db_xref="GOA:B8I9S7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S7"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACL55330.1"
FT                   /translation="MDFHRRFTVLMCAPAFDPDDLEGARVNQIVAAVEARGFEVVRARR
FT                   VEDAAIAVQTDAAIGCMVVDWGKRGLDGKAAALIDMMRQRGLEMPIVIMVRRKRLEDIP
FT                   VELLDFIDGYIFLAEETPEFIARGLVSRVTQYAETLKTPFFGALVDYAEKGNQLWTCPG
FT                   HNGGIFYNRSPIGRIFVEHLGEAIFRDDLDNSVLDLGDLLTHEGPALKAQKEAAAIFGA
FT                   EKTYFVLNGTSASNKIVLSALVAEDDLVLFDRNNHKAAHHGALFLGGGIPIFLETDRNA
FT                   HGLIGPIYHEAFDEAAIRDKIRRNPLVRDRQAWRRQRPFRVAVIEQCTYDGTIYDAREI
FT                   LARIGHLCDYILFDEAWAGFMKFHPLYAGRFAMGLDGLGPDSPGIIATQSTHKQLASFS
FT                   QASQIHTKDGHIRGQSRRVEHRRLNESFLVHASTSPFYPLFASLDVGAQMMKGRSGMIL
FT                   WDDTIRLGIEWRKKVRAIRKEFEENEADPQRRWFFDPFVPDLVEGPDGTVLPWESLPTD
FT                   LLASEPRYWELAPGARWHGFTKVAPGYAITDPNKLTVLTPGFDRETGEYAEHGVPAPIV
FT                   AQYLRENRIVPEKNDLNSLLFLLTPGVESSKAGTLISGLVAFKRLHDDNVPLEEAMPDF
FT                   VRRRPRRYQGVRLRDLCAEFHAFHREAGTSTLQRKQFAPEHLPEMAMPPKAAAQMLTRN
FT                   QVDFVPIAEAAGRIATTLMLVYPPGIGTVLPGERLDERAKPMLDYFTMFETSANLFPGF
FT                   EAEIQGVYRQVEPDGRIRFYTYVLREGAGTTAR"
     MDFHRRFTVL MCAPAFDPDD LEGARVNQIV AAVEARGFEV VRARRVEDAA IAVQTDAAIG        60
     CMVVDWGKRG LDGKAAALID MMRQRGLEMP IVIMVRRKRL EDIPVELLDF IDGYIFLAEE       120
     TPEFIARGLV SRVTQYAETL KTPFFGALVD YAEKGNQLWT CPGHNGGIFY NRSPIGRIFV       180
     EHLGEAIFRD DLDNSVLDLG DLLTHEGPAL KAQKEAAAIF GAEKTYFVLN GTSASNKIVL       240
     SALVAEDDLV LFDRNNHKAA HHGALFLGGG IPIFLETDRN AHGLIGPIYH EAFDEAAIRD       300
     KIRRNPLVRD RQAWRRQRPF RVAVIEQCTY DGTIYDAREI LARIGHLCDY ILFDEAWAGF       360
     MKFHPLYAGR FAMGLDGLGP DSPGIIATQS THKQLASFSQ ASQIHTKDGH IRGQSRRVEH       420
     RRLNESFLVH ASTSPFYPLF ASLDVGAQMM KGRSGMILWD DTIRLGIEWR KKVRAIRKEF       480
     EENEADPQRR WFFDPFVPDL VEGPDGTVLP WESLPTDLLA SEPRYWELAP GARWHGFTKV       540
     APGYAITDPN KLTVLTPGFD RETGEYAEHG VPAPIVAQYL RENRIVPEKN DLNSLLFLLT       600
     PGVESSKAGT LISGLVAFKR LHDDNVPLEE AMPDFVRRRP RRYQGVRLRD LCAEFHAFHR       660
     EAGTSTLQRK QFAPEHLPEM AMPPKAAAQM LTRNQVDFVP IAEAAGRIAT TLMLVYPPGI       720
     GTVLPGERLD ERAKPMLDYF TMFETSANLF PGFEAEIQGV YRQVEPDGRI RFYTYVLREG       780
     AGTTAR                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page