(data stored in ACNUC7421 zone)

EMBL: CP001349.PE279

CP001349.PE279       Location/Qualifiers
FT   CDS             complement(322083..325568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0287"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: met:M446_2324 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55331"
FT                   /db_xref="GOA:B8I9S8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S8"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACL55331.1"
FT                   /translation="MGRQSAVSSLRPVSLEDKYDLSREQVFITGTQAVIRMLLMQQARD
FT                   RAAGLNTAGFVSGYRGSPIAGLDLNLYKARKVLEAANIVFQPGLNEELAATAIWGAQQA
FT                   EIRGEGRYDGVFGLWYGKGPGVDRAGDVFRHANTAGSSRYGGVLALMGDDHTAESSTLA
FT                   HQSEFHFVDVMMPILNPAGVQEILDYGLYGYAMSRYCGTWVAFKCVKDNIESTASVDAR
FT                   LDRVRIVQPDDFAMPPGGLNIRTPDVILEQEARLQDYKRDAMMAFVRANNLNRIILSGG
FT                   RQPKIGVITVGKSYLDVRQALDDLGLDEVKANDMGLRLYKVACPWPLSQRELLAFAEGL
FT                   DLIMVVEEKRSLIEVQVREELYGTANQPICVGKRDEAGRWLFPVKGALDPNDIAVALGE
FT                   RLLRYHRNDDLAGRVAALRQAQEILAATTDIAVRTPHFCAGCPHNSSTRIPEGARAYAG
FT                   IGCHYMAQWMERGTDGCTQMGGEGANWIGEAPFSKRTHVFQNLGDGTYNHSGSLALRWA
FT                   VDTGTTITYKILFNDAVAMTGGQPHEGGLTVDRIAQQVRAEGVERIALVTDEPHKYPSG
FT                   MRWPEGLTIHHRDDLDTVQRDLATVPGVSVLIYDQTCAAEKRRRRKRGRFPDPDKRVII
FT                   NDLVCEGCGDCSVQSNCVAVQPLETEFGRKRRIDQSSCNKDFSCLNGFCPSFVTVHGGK
FT                   PRTHPLVPLPGTPDEGLPEPVLPPIEGTYNIIVTGVGGTGVVTVGAILGMAAHLEGKGL
FT                   GMIDMAGLAQKGGAVFSHVRLAQAQDDIHAIRVTAGAADLILGCDLVVTGTRKVLAAVR
FT                   PGRTHVVVNTAEIMPGDFTRRPDFSLPVERIKRVIREKAGPAHADLTDATGLAVAALGN
FT                   AIAANMFMLGYAWQRGRVPLSRAAILKAIELNREAVPMNLAAFAWGRRAAAAPETLGAL
FT                   KAATASDLSADLDTLIARRVAFLTDYQDAAYAQRYARIVASVREREAAVHPGGSPLTEA
FT                   VARSLFKLMAYKDEYEVARLYTDGHFEAQIRNTFEGEGLRYEFHLAPPLLARTDPRTGR
FT                   PRKMSFGPWVLRVFRMLARMKRLRGTALDPFGYTQERREERRLIGEFETLVAEILRDLT
FT                   PANHAVAVGLANLPLTIRGFGPVKAKSLAAAKQEEAVLLTRFRAPEAPLAAAAE"
     MGRQSAVSSL RPVSLEDKYD LSREQVFITG TQAVIRMLLM QQARDRAAGL NTAGFVSGYR        60
     GSPIAGLDLN LYKARKVLEA ANIVFQPGLN EELAATAIWG AQQAEIRGEG RYDGVFGLWY       120
     GKGPGVDRAG DVFRHANTAG SSRYGGVLAL MGDDHTAESS TLAHQSEFHF VDVMMPILNP       180
     AGVQEILDYG LYGYAMSRYC GTWVAFKCVK DNIESTASVD ARLDRVRIVQ PDDFAMPPGG       240
     LNIRTPDVIL EQEARLQDYK RDAMMAFVRA NNLNRIILSG GRQPKIGVIT VGKSYLDVRQ       300
     ALDDLGLDEV KANDMGLRLY KVACPWPLSQ RELLAFAEGL DLIMVVEEKR SLIEVQVREE       360
     LYGTANQPIC VGKRDEAGRW LFPVKGALDP NDIAVALGER LLRYHRNDDL AGRVAALRQA       420
     QEILAATTDI AVRTPHFCAG CPHNSSTRIP EGARAYAGIG CHYMAQWMER GTDGCTQMGG       480
     EGANWIGEAP FSKRTHVFQN LGDGTYNHSG SLALRWAVDT GTTITYKILF NDAVAMTGGQ       540
     PHEGGLTVDR IAQQVRAEGV ERIALVTDEP HKYPSGMRWP EGLTIHHRDD LDTVQRDLAT       600
     VPGVSVLIYD QTCAAEKRRR RKRGRFPDPD KRVIINDLVC EGCGDCSVQS NCVAVQPLET       660
     EFGRKRRIDQ SSCNKDFSCL NGFCPSFVTV HGGKPRTHPL VPLPGTPDEG LPEPVLPPIE       720
     GTYNIIVTGV GGTGVVTVGA ILGMAAHLEG KGLGMIDMAG LAQKGGAVFS HVRLAQAQDD       780
     IHAIRVTAGA ADLILGCDLV VTGTRKVLAA VRPGRTHVVV NTAEIMPGDF TRRPDFSLPV       840
     ERIKRVIREK AGPAHADLTD ATGLAVAALG NAIAANMFML GYAWQRGRVP LSRAAILKAI       900
     ELNREAVPMN LAAFAWGRRA AAAPETLGAL KAATASDLSA DLDTLIARRV AFLTDYQDAA       960
     YAQRYARIVA SVREREAAVH PGGSPLTEAV ARSLFKLMAY KDEYEVARLY TDGHFEAQIR      1020
     NTFEGEGLRY EFHLAPPLLA RTDPRTGRPR KMSFGPWVLR VFRMLARMKR LRGTALDPFG      1080
     YTQERREERR LIGEFETLVA EILRDLTPAN HAVAVGLANL PLTIRGFGPV KAKSLAAAKQ      1140
     EEAVLLTRFR APEAPLAAAA E                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page