(data stored in ACNUC7421 zone)

EMBL: CP001349.PE280

CP001349.PE280       Location/Qualifiers
FT   CDS             complement(325792..327486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0288"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2319 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55332"
FT                   /db_xref="GOA:B8I9S9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55332.1"
FT                   /translation="MTHPRASYVHGACEVPLLGRTIGQALSAAAEAWPDHPALIAPAGE
FT                   VRWSWAELNARAEAFAAGLLALGLERGDRIGIWSLNNAEWALTQFAAAKAGLILVTVNP
FT                   AYRLAELEFALNKVGCKALVTARAFKSSDYIGMLTSLAPELREAAPGRLRAARLPALRT
FT                   VIEIGGGESPGTLPFAAVAERAGATERDRISAHAGALQFDDPVNIQFTSGTTGSPKGVT
FT                   LTHHNILNNGYFVGRAMRLSPEDRICIPVPLYHCFGMVMGNLAAVSSGAAMVYPGEGFD
FT                   PLATLRAVEAERCTALYGVPTMFLAELDHPDFARFDLSSLRTGIMAGSPCPIAVMQRAV
FT                   DRMHLTQLTICYGMTETSPVSFQSAVDDPLERRVSTVGRIHPHTEVKVVDAEGRIVPRG
FT                   TPGELCTRGYSVMQGYWGDPEKTAEVRDAAGWMHTGDLATLDEDGFCNIVGRIKDLVIR
FT                   GGENVYPREVEEFLYRHPAIQEVQVFGVPDPRYGEELCAWVRLRPGAALTAEGLRAHCA
FT                   GQIAHQKIPRYVEFVEEFPTTVTGKMQKYRMRQAMVEKLGLVAEKTA"
     MTHPRASYVH GACEVPLLGR TIGQALSAAA EAWPDHPALI APAGEVRWSW AELNARAEAF        60
     AAGLLALGLE RGDRIGIWSL NNAEWALTQF AAAKAGLILV TVNPAYRLAE LEFALNKVGC       120
     KALVTARAFK SSDYIGMLTS LAPELREAAP GRLRAARLPA LRTVIEIGGG ESPGTLPFAA       180
     VAERAGATER DRISAHAGAL QFDDPVNIQF TSGTTGSPKG VTLTHHNILN NGYFVGRAMR       240
     LSPEDRICIP VPLYHCFGMV MGNLAAVSSG AAMVYPGEGF DPLATLRAVE AERCTALYGV       300
     PTMFLAELDH PDFARFDLSS LRTGIMAGSP CPIAVMQRAV DRMHLTQLTI CYGMTETSPV       360
     SFQSAVDDPL ERRVSTVGRI HPHTEVKVVD AEGRIVPRGT PGELCTRGYS VMQGYWGDPE       420
     KTAEVRDAAG WMHTGDLATL DEDGFCNIVG RIKDLVIRGG ENVYPREVEE FLYRHPAIQE       480
     VQVFGVPDPR YGEELCAWVR LRPGAALTAE GLRAHCAGQI AHQKIPRYVE FVEEFPTTVT       540
     GKMQKYRMRQ AMVEKLGLVA EKTA                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page