(data stored in ACNUC7421 zone)

EMBL: CP001349.PE281

CP001349.PE281       Location/Qualifiers
FT   CDS             327664..328839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0289"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: met:M446_2318
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55333"
FT                   /db_xref="GOA:B8IAU0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACL55333.1"
FT                   /translation="MIPNAAREFNFGLGETADAIRESVRDFARDRIAPRAEEIDRTNTF
FT                   PRDLWPEMGALGLHGITVEEEYGGLGLGYLEHCVAMEEVSRASASVGLSYGAHSNLCIN
FT                   QIRRNGSDAQKRRYLPKLISGDEVGALAMSEPGSGSDVVSMRTRAEKRGDRYVLTGSKM
FT                   WITNGPEAETLVVYAKTDPAAGPRGITAFLIEKGMKGFSTAQKLDKLGMRGSDTCELVF
FT                   EECEVPEENVLGEVGRGVNVLMSGLDYERAVLAAGPLGIMQACLDVVLPYVHERKQFGQ
FT                   PIGEFQLVQGKLADMYVATNAAKAYVYAVAQACDRGETTREDAAGAILYAAERATQCAL
FT                   DAIQLLGGNGYINDYPTGRLLRDAKLYEIGAGTSEIRRMLIGRELFAKSSA"
     MIPNAAREFN FGLGETADAI RESVRDFARD RIAPRAEEID RTNTFPRDLW PEMGALGLHG        60
     ITVEEEYGGL GLGYLEHCVA MEEVSRASAS VGLSYGAHSN LCINQIRRNG SDAQKRRYLP       120
     KLISGDEVGA LAMSEPGSGS DVVSMRTRAE KRGDRYVLTG SKMWITNGPE AETLVVYAKT       180
     DPAAGPRGIT AFLIEKGMKG FSTAQKLDKL GMRGSDTCEL VFEECEVPEE NVLGEVGRGV       240
     NVLMSGLDYE RAVLAAGPLG IMQACLDVVL PYVHERKQFG QPIGEFQLVQ GKLADMYVAT       300
     NAAKAYVYAV AQACDRGETT REDAAGAILY AAERATQCAL DAIQLLGGNG YINDYPTGRL       360
     LRDAKLYEIG AGTSEIRRML IGRELFAKSS A                                      391
//

If you have problems or comments...

PBIL Back to PBIL home page