(data stored in ACNUC7421 zone)

EMBL: CP001349.PE282

CP001349.PE282       Location/Qualifiers
FT   CDS             328849..330456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0290"
FT                   /product="carboxyl transferase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: met:M446_2317
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55334"
FT                   /db_xref="GOA:B8IAU1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU1"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACL55334.1"
FT                   /translation="MPVLPTTADLASAEAGRNRAAWSELRTTLKARRAEAAAGGPPRAR
FT                   ERHRARGKLLPRDRVLRLLDPGSPFLEIGALAAYGMYDDAIHAAGLIAGIGRVAGREVM
FT                   IVCNDATIKGGTYFPVTVKKHLRAQEIARENRLPCLYLVDSGGANLPQQTEVFPDREHF
FT                   GRIFYNQAQLSAAGIPQIACVMGSCTAGGAYVPAMSDESVIVRRQGTIFLGGPPLVKAA
FT                   TGEVVSAEDLGGADVHARLSGVADHYATDDAHALAILRRIVGTLNSVKRPDLDLTASCD
FT                   PLHDAADLDAVVPVDLRKQYDSREIIARLVDGSEFDEFKRLYGTTLVTGFARLWGMPVG
FT                   ILANNGILYSESALKGAHFIELCCQRRVPLLFLQNIAGFMVGREVEAGGIARNGAKLVT
FT                   AVATAAVPKLTVLVGGSYGAGNYGMCGRAYGPRFLFAWPNSRISVMGAEQAASVLATVR
FT                   RDNLEAAGETWSAEEEEAFKAPIREQFEAEGSPYYATARLWDDGIILPEETRRVLGLAL
FT                   SACLNAPVPETRFGLFRM"
     MPVLPTTADL ASAEAGRNRA AWSELRTTLK ARRAEAAAGG PPRARERHRA RGKLLPRDRV        60
     LRLLDPGSPF LEIGALAAYG MYDDAIHAAG LIAGIGRVAG REVMIVCNDA TIKGGTYFPV       120
     TVKKHLRAQE IARENRLPCL YLVDSGGANL PQQTEVFPDR EHFGRIFYNQ AQLSAAGIPQ       180
     IACVMGSCTA GGAYVPAMSD ESVIVRRQGT IFLGGPPLVK AATGEVVSAE DLGGADVHAR       240
     LSGVADHYAT DDAHALAILR RIVGTLNSVK RPDLDLTASC DPLHDAADLD AVVPVDLRKQ       300
     YDSREIIARL VDGSEFDEFK RLYGTTLVTG FARLWGMPVG ILANNGILYS ESALKGAHFI       360
     ELCCQRRVPL LFLQNIAGFM VGREVEAGGI ARNGAKLVTA VATAAVPKLT VLVGGSYGAG       420
     NYGMCGRAYG PRFLFAWPNS RISVMGAEQA ASVLATVRRD NLEAAGETWS AEEEEAFKAP       480
     IREQFEAEGS PYYATARLWD DGIILPEETR RVLGLALSAC LNAPVPETRF GLFRM            535
//

If you have problems or comments...

PBIL Back to PBIL home page