(data stored in ACNUC7421 zone)

EMBL: CP001349.PE283

CP001349.PE283       Location/Qualifiers
FT   CDS             330749..332698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0291"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   met:M446_2316 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55335"
FT                   /db_xref="GOA:B8IAU2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU2"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACL55335.1"
FT                   /translation="MTGLRSVLIANRGEIACRVIRTAKRLGLRTIAVHSEADRSALHVA
FT                   MADEAHLIGPAPAAESYLRIDRILEAAAQAGADCIHPGYGFLSERPDFAEACAAAGLVF
FT                   VGPPAPAICAMGLKDAAKALVAKAGVPVVPGYHGARQEPDFLAAEAAAIGYPVLIKAVA
FT                   GGGGKGMRRVERSEDFAAALEGAQREALAAFGDPRVLVEKYVLAPRHVEIQVFCDAHGH
FT                   AVHLFERDCSLQRRHQKVIEEAPAPGMSPAVRAAMGRAAVEAARAVGYVGAGTVEFIAD
FT                   GREGLTTDGFWFMEMNTRLQVEHPVTEAITGVDLVEWQFRVAAGEPLPCGQDDLAIRGH
FT                   AVEARLYAEDPAADFLPSTGRLRALDLPTGDGIRVDTGVRAGDLVSPFYDPMIAKVIAH
FT                   GETRGQALDRLAQALERTLVAGPRANVAFLKALAEAEEFRAGRFDTGFIDRHLDALTGR
FT                   AAGIDPEAIRQGVAALIARAQGVPGAPTSPWEVADGFQLGAGRRQAWPVLVEGEARAVT
FT                   LAWPEGGGAMAIEAGEAARAPRPRPRGADRTRHARRGGRPAGGGGAARSLRCRSRPHRY
FT                   GRERQGTDAWPPRRHPRRPGRAGDARPAPRHRRGDEDGARPHRPRRRRGHGGGGGGRRA
FT                   GCRGRAPDHHPHGG"
     MTGLRSVLIA NRGEIACRVI RTAKRLGLRT IAVHSEADRS ALHVAMADEA HLIGPAPAAE        60
     SYLRIDRILE AAAQAGADCI HPGYGFLSER PDFAEACAAA GLVFVGPPAP AICAMGLKDA       120
     AKALVAKAGV PVVPGYHGAR QEPDFLAAEA AAIGYPVLIK AVAGGGGKGM RRVERSEDFA       180
     AALEGAQREA LAAFGDPRVL VEKYVLAPRH VEIQVFCDAH GHAVHLFERD CSLQRRHQKV       240
     IEEAPAPGMS PAVRAAMGRA AVEAARAVGY VGAGTVEFIA DGREGLTTDG FWFMEMNTRL       300
     QVEHPVTEAI TGVDLVEWQF RVAAGEPLPC GQDDLAIRGH AVEARLYAED PAADFLPSTG       360
     RLRALDLPTG DGIRVDTGVR AGDLVSPFYD PMIAKVIAHG ETRGQALDRL AQALERTLVA       420
     GPRANVAFLK ALAEAEEFRA GRFDTGFIDR HLDALTGRAA GIDPEAIRQG VAALIARAQG       480
     VPGAPTSPWE VADGFQLGAG RRQAWPVLVE GEARAVTLAW PEGGGAMAIE AGEAARAPRP       540
     RPRGADRTRH ARRGGRPAGG GGAARSLRCR SRPHRYGRER QGTDAWPPRR HPRRPGRAGD       600
     ARPAPRHRRG DEDGARPHRP RRRRGHGGGG GGRRAGCRGR APDHHPHGG                   649
//

If you have problems or comments...

PBIL Back to PBIL home page