(data stored in ACNUC7421 zone)

EMBL: CP001349.PE284

CP001349.PE284       Location/Qualifiers
FT   CDS             332702..333202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0292"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_2315 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55336"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU3"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55336.1"
FT                   /translation="MTNPLPVSTHPRGGLYFEDFEVGRVLRHRLTRTVTQMDNMLFSTM
FT                   TLNPQPLHIDAHFCATETEWGRPLMNSLFTLGLMIGISVNDTTVGTTIGNLGMTDVRFP
FT                   APLFEGDTIRVETEVAGKRESRSRPNAGLVEFIHRAYKQDGTLVAECRRQALMRRHPPA
FT                   ETA"
     MTNPLPVSTH PRGGLYFEDF EVGRVLRHRL TRTVTQMDNM LFSTMTLNPQ PLHIDAHFCA        60
     TETEWGRPLM NSLFTLGLMI GISVNDTTVG TTIGNLGMTD VRFPAPLFEG DTIRVETEVA       120
     GKRESRSRPN AGLVEFIHRA YKQDGTLVAE CRRQALMRRH PPAETA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page