(data stored in ACNUC7421 zone)

EMBL: CP001349.PE285

CP001349.PE285       Location/Qualifiers
FT   CDS             333202..334077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0293"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: met:M446_2314
FT                   citrate (pro-3S)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55337"
FT                   /db_xref="GOA:B8IAU4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU4"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACL55337.1"
FT                   /translation="MRSLLFVPGDSARKLDKALDSGADALILDLEDSVAMAEKPAARAA
FT                   TAGFLARARDLPARPRLYVRINALETGLADDDLAAVMPASPDGIVLPKAAGGPDVAALG
FT                   ARLAVHEAEAGLADCATRILPIATETAQAVFALGTLAGSSPRLAGVTWGAEDLSADLGA
FT                   ETNRGEDGGWSAPFRLARNLALLAAAAAEVDAIDTINAAFRDLDGLARECREARRDGFV
FT                   GKMAIHPAQVPVINAAFTPSEAELARARAVVAAFAQAPGTGVVGVEGQMLDRPHLRRAE
FT                   RLLARVGGGV"
     MRSLLFVPGD SARKLDKALD SGADALILDL EDSVAMAEKP AARAATAGFL ARARDLPARP        60
     RLYVRINALE TGLADDDLAA VMPASPDGIV LPKAAGGPDV AALGARLAVH EAEAGLADCA       120
     TRILPIATET AQAVFALGTL AGSSPRLAGV TWGAEDLSAD LGAETNRGED GGWSAPFRLA       180
     RNLALLAAAA AEVDAIDTIN AAFRDLDGLA RECREARRDG FVGKMAIHPA QVPVINAAFT       240
     PSEAELARAR AVVAAFAQAP GTGVVGVEGQ MLDRPHLRRA ERLLARVGGG V                291
//

If you have problems or comments...

PBIL Back to PBIL home page