(data stored in ACNUC7421 zone)

EMBL: CP001349.PE286

CP001349.PE286       Location/Qualifiers
FT   CDS             334144..335376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0294"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /note="KEGG: met:M446_2311 putative phenylacetate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55338"
FT                   /db_xref="GOA:B8IAU5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU5"
FT                   /inference="similar to AA sequence:KEGG:M446_2311"
FT                   /protein_id="ACL55338.1"
FT                   /translation="MPEHYDARETESPAARDAALFARLPDILAAALRSPGYAAHLGEID
FT                   PAAITDRTALARLPVLRKSEMPEKQRGALPFGGFVPGEPGRFPRLFTSPGPIFEPQRSG
FT                   EDPWGGARCLFAAGFRPGDVVLNTFGYHLTPGGFIFDTAARALGCAVIPAGPGNTEQQL
FT                   DLIEAYRPTGYCGTPDFLRILVEAGRAAGRNISSLRRSVVSGAAFPKSLQEIVAGFGIA
FT                   AYQAYATADVGFIAYETSARDGLVVNEDLILEIVRPGTGDPVPEGEVGEIVVTVLDPDR
FT                   PLIRYALGDLTAALGHASSCGRTAPRIRGWMGRADQAAKVKGMFVRPEQVAELARRHPE
FT                   LKRLRLVVTRADETDAMTLKAETAEPGRALADAVAESLQAVTKLRGAVELVAPGSLPND
FT                   GKVIADERPTG"
     MPEHYDARET ESPAARDAAL FARLPDILAA ALRSPGYAAH LGEIDPAAIT DRTALARLPV        60
     LRKSEMPEKQ RGALPFGGFV PGEPGRFPRL FTSPGPIFEP QRSGEDPWGG ARCLFAAGFR       120
     PGDVVLNTFG YHLTPGGFIF DTAARALGCA VIPAGPGNTE QQLDLIEAYR PTGYCGTPDF       180
     LRILVEAGRA AGRNISSLRR SVVSGAAFPK SLQEIVAGFG IAAYQAYATA DVGFIAYETS       240
     ARDGLVVNED LILEIVRPGT GDPVPEGEVG EIVVTVLDPD RPLIRYALGD LTAALGHASS       300
     CGRTAPRIRG WMGRADQAAK VKGMFVRPEQ VAELARRHPE LKRLRLVVTR ADETDAMTLK       360
     AETAEPGRAL ADAVAESLQA VTKLRGAVEL VAPGSLPNDG KVIADERPTG                  410
//

If you have problems or comments...

PBIL Back to PBIL home page