(data stored in ACNUC7421 zone)

EMBL: CP001349.PE287

CP001349.PE287       Location/Qualifiers
FT   CDS             complement(335348..336010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0295"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2310
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55339"
FT                   /db_xref="GOA:B8IAU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55339.1"
FT                   /translation="MARIAGSSGPKTEEAIRRAGLQLLYTHGYAAMSLRQLAGAVGIQQ
FT                   GSLYNYFRNKQEFLFELIRSHMRDLHAALDAALLPEGNGVARLTRFVEFHVAYHIERPQ
FT                   EVFICYSELRSLEPENFSAIVAMRRDYEDKLIEILEFGRATGEFRLADTRMAAYAILAM
FT                   LSGICTWYRPGGRLSKDEVRETFLGMVLSLVSGVGMEESLPEPPRLAEVSRSGARRR"
     MARIAGSSGP KTEEAIRRAG LQLLYTHGYA AMSLRQLAGA VGIQQGSLYN YFRNKQEFLF        60
     ELIRSHMRDL HAALDAALLP EGNGVARLTR FVEFHVAYHI ERPQEVFICY SELRSLEPEN       120
     FSAIVAMRRD YEDKLIEILE FGRATGEFRL ADTRMAAYAI LAMLSGICTW YRPGGRLSKD       180
     EVRETFLGMV LSLVSGVGME ESLPEPPRLA EVSRSGARRR                             220
//

If you have problems or comments...

PBIL Back to PBIL home page