(data stored in ACNUC7421 zone)

EMBL: CP001349.PE288

CP001349.PE288       Location/Qualifiers
FT   CDS             336206..337015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0296"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2309 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55340"
FT                   /db_xref="GOA:B8IAU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55340.1"
FT                   /translation="MAEALEVRHVSLRFGGVKALTDVGFTVEQGELFSIIGPNGAGKTS
FT                   MLNCISGRYRPTEGQILFQGRDITRATPNARPKLGIGRTFQNLALFHHMSVLDNIMVGR
FT                   HHLLRNNFLTGSLYWLPGVRSEELAHRRRVEEIIDFLDLQAYRKATAGTLSYGLRKRVE
FT                   LARAMALEPRLILLDEPMAGMNLEEKEDMARYIVDLNEEFGMTVVMIEHDMGVVMDISH
FT                   RVMVLDFGRRIALGRPEAVLADPHVRRAYLGEEDEAEDAQAPIRAVS"
     MAEALEVRHV SLRFGGVKAL TDVGFTVEQG ELFSIIGPNG AGKTSMLNCI SGRYRPTEGQ        60
     ILFQGRDITR ATPNARPKLG IGRTFQNLAL FHHMSVLDNI MVGRHHLLRN NFLTGSLYWL       120
     PGVRSEELAH RRRVEEIIDF LDLQAYRKAT AGTLSYGLRK RVELARAMAL EPRLILLDEP       180
     MAGMNLEEKE DMARYIVDLN EEFGMTVVMI EHDMGVVMDI SHRVMVLDFG RRIALGRPEA       240
     VLADPHVRRA YLGEEDEAED AQAPIRAVS                                         269
//

If you have problems or comments...

PBIL Back to PBIL home page