(data stored in ACNUC7421 zone)

EMBL: CP001349.PE289

CP001349.PE289       Location/Qualifiers
FT   CDS             337015..338946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0297"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2308 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55341"
FT                   /db_xref="GOA:B8IAU8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55341.1"
FT                   /translation="MGTDFAARAAKADTFPKLLALNAREHPHAVALREKDLGLWRPTTW
FT                   SQYQDRVRAFALGLRDLGIGEGDVVGLIGDNRPDWVAGEIAAHALGALTLGLYRDALED
FT                   EVHYLLDYGEARVVFAEDEEQVDKLIGLADRVPSLRHIVYSDPRGMRKYDDRRLISAEA
FT                   LARRGAALEAAEPGLYERLVEATDGEAVAILCTTSGTTARPKLAMLSAGRVLRHCASYL
FT                   AADPKGPEDDYVSVLPLPWIMEQIYALGQALLSRMTVNFVEEADTLMHDFREIAPTFVL
FT                   FAPRVWEAIAADVRARMMDASPLKRWLYERGMARGLRALEAGRRSPVAEAVLFRALRDR
FT                   LGFTRLRSAATGGAALGPDTFRFFRALGVPLRQLYGQTEAMGAYTLHRGDRVDFDTVGM
FT                   PFDDSITVRIVDPDRNGIGEIWARHDNMFLGYYKAPEGTGDVVDGWMHTGDAGYLDAKG
FT                   ELVVIDRVKDLALNARGERFSPQYLENKLKFSPYVAEAVILGAGRDDLAAVICIRFSVV
FT                   AKWAEKNRIAFTTYSDLAAKPEVIALLKAEVERVNASLPETQRIARFVLLYKELDADDG
FT                   ELTRTRKVRRGVINEKYADLIAAIYAGQPSYRVDTVIRFQDGSTQRIRTTLPVTDLRRA
FT                   VPVLAAAE"
     MGTDFAARAA KADTFPKLLA LNAREHPHAV ALREKDLGLW RPTTWSQYQD RVRAFALGLR        60
     DLGIGEGDVV GLIGDNRPDW VAGEIAAHAL GALTLGLYRD ALEDEVHYLL DYGEARVVFA       120
     EDEEQVDKLI GLADRVPSLR HIVYSDPRGM RKYDDRRLIS AEALARRGAA LEAAEPGLYE       180
     RLVEATDGEA VAILCTTSGT TARPKLAMLS AGRVLRHCAS YLAADPKGPE DDYVSVLPLP       240
     WIMEQIYALG QALLSRMTVN FVEEADTLMH DFREIAPTFV LFAPRVWEAI AADVRARMMD       300
     ASPLKRWLYE RGMARGLRAL EAGRRSPVAE AVLFRALRDR LGFTRLRSAA TGGAALGPDT       360
     FRFFRALGVP LRQLYGQTEA MGAYTLHRGD RVDFDTVGMP FDDSITVRIV DPDRNGIGEI       420
     WARHDNMFLG YYKAPEGTGD VVDGWMHTGD AGYLDAKGEL VVIDRVKDLA LNARGERFSP       480
     QYLENKLKFS PYVAEAVILG AGRDDLAAVI CIRFSVVAKW AEKNRIAFTT YSDLAAKPEV       540
     IALLKAEVER VNASLPETQR IARFVLLYKE LDADDGELTR TRKVRRGVIN EKYADLIAAI       600
     YAGQPSYRVD TVIRFQDGST QRIRTTLPVT DLRRAVPVLA AAE                         643
//

If you have problems or comments...

PBIL Back to PBIL home page