(data stored in ACNUC7421 zone)

EMBL: CP001349.PE29

CP001349.PE29        Location/Qualifiers
FT   CDS             complement(29671..30090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0030"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_0027 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55081"
FT                   /db_xref="GOA:B8IT19"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT19"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55081.1"
FT                   /translation="MPATEDTTTDLPRGDLTVRTIAMPADTNANGDIFGGWVMSQMDQA
FT                   GGIAGVERAQGRVVTVAVEGMSFIRPVRVGDVLCVYTRVVQVGRTSMRIEIEAWARRFR
FT                   TQLREKVTQASFTFVAIDDEGRPRPVPPAPKAERP"
     MPATEDTTTD LPRGDLTVRT IAMPADTNAN GDIFGGWVMS QMDQAGGIAG VERAQGRVVT        60
     VAVEGMSFIR PVRVGDVLCV YTRVVQVGRT SMRIEIEAWA RRFRTQLREK VTQASFTFVA       120
     IDDEGRPRPV PPAPKAERP                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page