(data stored in ACNUC7421 zone)

EMBL: CP001349.PE290

CP001349.PE290       Location/Qualifiers
FT   CDS             338959..339852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0298"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2307 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55342"
FT                   /db_xref="GOA:B8IAU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55342.1"
FT                   /translation="MTSHLLVQLVLNGLIVGALYGVVAMSFVLIYKASQVVNFAQGEFL
FT                   LIGAWICWWLLTTYQLPFVVGMLVTFAFMLVFGIALQVVVLRPLIGEPIISVIMVTIGL
FT                   SIFFQALCKWLFGVFAQPFPPIFATQSVSILGLEIQTVYLMSLGISVAMMAAFAWFFRF
FT                   SRHGLAMRATAFDQQVAQSLGIPVRNVFAMAWAISAVVSSVAGIVVGIVNGVSSALSLY
FT                   GIKVFPAVILGGLDSVVGAVIGGLVIGLLENIAQYVDGQYLHWGNLYEIVPFYVLVVIL
FT                   MIKPYGLFGTRDIERV"
     MTSHLLVQLV LNGLIVGALY GVVAMSFVLI YKASQVVNFA QGEFLLIGAW ICWWLLTTYQ        60
     LPFVVGMLVT FAFMLVFGIA LQVVVLRPLI GEPIISVIMV TIGLSIFFQA LCKWLFGVFA       120
     QPFPPIFATQ SVSILGLEIQ TVYLMSLGIS VAMMAAFAWF FRFSRHGLAM RATAFDQQVA       180
     QSLGIPVRNV FAMAWAISAV VSSVAGIVVG IVNGVSSALS LYGIKVFPAV ILGGLDSVVG       240
     AVIGGLVIGL LENIAQYVDG QYLHWGNLYE IVPFYVLVVI LMIKPYGLFG TRDIERV          297
//

If you have problems or comments...

PBIL Back to PBIL home page