(data stored in ACNUC7421 zone)

EMBL: CP001349.PE291

CP001349.PE291       Location/Qualifiers
FT   CDS             339860..340933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0299"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2306 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55343"
FT                   /db_xref="GOA:B8IAV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55343.1"
FT                   /translation="MATQSLIPAGDFRTSYAADTTLFPTAGSRYAVWAGLALLCLAPLI
FT                   LDRYWLSLLIQIGYFAVAALGLNILVGFTGQISIGHAAFFGFGAFASAWLSNNLAIPVF
FT                   FAIPLSGIVTTAVGLVFGLPAARLKGLYLAIATLAAQYILQDFFARANWFTGGVAGTPA
FT                   EAFSILGFAFDTDQRYFYVVLAYLVLTFVLASNLMHSRDGRALVAVRDHYLSAEMMGIN
FT                   LTRYRTLSFGLSAFFAGVGGALYAHYLQFVSVEGFGILLSIQFLGMIIIGGLGSIMGTL
FT                   MGTAFMVLVPEAMGWITDAVRGSALDRALALKDNLSFLREMAIGLVIVLFLIFEPDGLA
FT                   HRWRQIKAYWKLYPFSH"
     MATQSLIPAG DFRTSYAADT TLFPTAGSRY AVWAGLALLC LAPLILDRYW LSLLIQIGYF        60
     AVAALGLNIL VGFTGQISIG HAAFFGFGAF ASAWLSNNLA IPVFFAIPLS GIVTTAVGLV       120
     FGLPAARLKG LYLAIATLAA QYILQDFFAR ANWFTGGVAG TPAEAFSILG FAFDTDQRYF       180
     YVVLAYLVLT FVLASNLMHS RDGRALVAVR DHYLSAEMMG INLTRYRTLS FGLSAFFAGV       240
     GGALYAHYLQ FVSVEGFGIL LSIQFLGMII IGGLGSIMGT LMGTAFMVLV PEAMGWITDA       300
     VRGSALDRAL ALKDNLSFLR EMAIGLVIVL FLIFEPDGLA HRWRQIKAYW KLYPFSH          357
//

If you have problems or comments...

PBIL Back to PBIL home page