(data stored in ACNUC7421 zone)

EMBL: CP001349.PE292

CP001349.PE292       Location/Qualifiers
FT   CDS             340992..342272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0300"
FT                   /product="putative branched-chain amino acid ABC transport
FT                   system substrate-binding protein"
FT                   /note="KEGG: met:M446_2305 putative branched-chain amino
FT                   acid ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55344"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV1"
FT                   /inference="similar to AA sequence:KEGG:M446_2305"
FT                   /protein_id="ACL55344.1"
FT                   /translation="MLRPITLVPALALGLALGLPARAADVPIGHLADQSGATSDVGVPY
FT                   AQGVADALAWINRKGGVGGQKLAVETVDYGYQVPRAVAQYKKWTSGRDRVAAIQGWGTA
FT                   DTEALSAFVAKDEIPYISGSYAAQVSDPTGSSGKAKAAPYNFFYGPTYSDALRAMLIWA
FT                   AEDWKSKGKAGKPKYVHMGGNHPYPNSPKEAGEAMAKELGFEVLPAIVFALAPGDYTAQ
FT                   CLTAKNAGANYAYLGNTGGSNISLLKSCKAVGADIQFMGNVWGMDENAAKAAGEAANGV
FT                   VFPVRTATVTGGSAPGLKTIAEISKESDPAGTAYRPVHYLAGVCAALYMSEAIGWAKDN
FT                   GGISGPNVRKGFYQKKNWVPAGLEGVCVPSTWSETDHRGMMVVNIYRAKVSGATDGALA
FT                   DLIRAGTVKLEPVKTVELPRKPDWLGW"
     MLRPITLVPA LALGLALGLP ARAADVPIGH LADQSGATSD VGVPYAQGVA DALAWINRKG        60
     GVGGQKLAVE TVDYGYQVPR AVAQYKKWTS GRDRVAAIQG WGTADTEALS AFVAKDEIPY       120
     ISGSYAAQVS DPTGSSGKAK AAPYNFFYGP TYSDALRAML IWAAEDWKSK GKAGKPKYVH       180
     MGGNHPYPNS PKEAGEAMAK ELGFEVLPAI VFALAPGDYT AQCLTAKNAG ANYAYLGNTG       240
     GSNISLLKSC KAVGADIQFM GNVWGMDENA AKAAGEAANG VVFPVRTATV TGGSAPGLKT       300
     IAEISKESDP AGTAYRPVHY LAGVCAALYM SEAIGWAKDN GGISGPNVRK GFYQKKNWVP       360
     AGLEGVCVPS TWSETDHRGM MVVNIYRAKV SGATDGALAD LIRAGTVKLE PVKTVELPRK       420
     PDWLGW                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page