(data stored in ACNUC7421 zone)

EMBL: CP001349.PE293

CP001349.PE293       Location/Qualifiers
FT   CDS             342397..343233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0301"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2304 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55345"
FT                   /db_xref="GOA:B8IAV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55345.1"
FT                   /translation="MPQITTLERPAAEAASAPLLALRNVEVVYDDVILVLRGLSLDVPA
FT                   GSITALLGANGAGKSTTLKAISGLLRSENGEVTRGEVLFDGERIDGIEPDLIVRRGIFQ
FT                   VMEGRRIIADMTPMENLRLGAFSRRDRAVAEDLERVLTYFPRLKERTGAAGYLSGGEQQ
FT                   MLAIGRALMARPRLILMDEPSMGLSPLLVKEVFSIIRQINRDLGVTILLVEQNARAALA
FT                   VADRGYIMEQGKVVLDGTVEELRANEDVKEFYLGGAGDQRKTFKNLKSFKRRKRWL"
     MPQITTLERP AAEAASAPLL ALRNVEVVYD DVILVLRGLS LDVPAGSITA LLGANGAGKS        60
     TTLKAISGLL RSENGEVTRG EVLFDGERID GIEPDLIVRR GIFQVMEGRR IIADMTPMEN       120
     LRLGAFSRRD RAVAEDLERV LTYFPRLKER TGAAGYLSGG EQQMLAIGRA LMARPRLILM       180
     DEPSMGLSPL LVKEVFSIIR QINRDLGVTI LLVEQNARAA LAVADRGYIM EQGKVVLDGT       240
     VEELRANEDV KEFYLGGAGD QRKTFKNLKS FKRRKRWL                               278
//

If you have problems or comments...

PBIL Back to PBIL home page