(data stored in ACNUC7421 zone)

EMBL: CP001349.PE295

CP001349.PE295       Location/Qualifiers
FT   CDS             343838..344839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0303"
FT                   /product="Asparaginase/glutaminase"
FT                   /EC_number="3.5.1.1"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: met:M446_2302
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55347"
FT                   /db_xref="GOA:B8IAV4"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV4"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACL55347.1"
FT                   /translation="MAQRPKVAFIGTGGTMSSIGRDRLDLLDYTATDKRLEADAILDAV
FT                   PEARAVAEVIPVRFRAVTSPAIGFGVWRDLVRLCEQQVAAHPDLAGIVIGHGTATLEET
FT                   AYALSLTLTVEVPVVLVGSQRPISALSSDAPLNLVNAIRTAAAPQSRGRGVLVVLNDEI
FT                   QAARDVTKTSVARMQTFRTADFGILGQVDGPSVTYYRRSERRYAPDTEFDIRALPALPR
FT                   VDISYGYADADGTAVRAFVAAGARGIVSAGLAPGMTPPAEADALETAAQAGILVVQSTR
FT                   AGSGIVPLTTRLHQRGILSADNLTPQKARILLALALTVTSDPRAVAEIFATY"
     MAQRPKVAFI GTGGTMSSIG RDRLDLLDYT ATDKRLEADA ILDAVPEARA VAEVIPVRFR        60
     AVTSPAIGFG VWRDLVRLCE QQVAAHPDLA GIVIGHGTAT LEETAYALSL TLTVEVPVVL       120
     VGSQRPISAL SSDAPLNLVN AIRTAAAPQS RGRGVLVVLN DEIQAARDVT KTSVARMQTF       180
     RTADFGILGQ VDGPSVTYYR RSERRYAPDT EFDIRALPAL PRVDISYGYA DADGTAVRAF       240
     VAAGARGIVS AGLAPGMTPP AEADALETAA QAGILVVQST RAGSGIVPLT TRLHQRGILS       300
     ADNLTPQKAR ILLALALTVT SDPRAVAEIF ATY                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page