(data stored in ACNUC7421 zone)

EMBL: CP001349.PE297

CP001349.PE297       Location/Qualifiers
FT   CDS             complement(345479..346777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0305"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_2300 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55349"
FT                   /db_xref="GOA:B8IAV6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55349.1"
FT                   /translation="MSNAFAAGGAPPASRRPFGRNYAFVVVGVVFLALLAAAGLRAAPG
FT                   VLILPLEQAFGWSRATISFSAGLGIFLYGLVGPFAAALMQSFGIRRTLLCALALMAAST
FT                   GLSAFMSEPWHLVATWGLLSGLGSGCVAIVLGATVVNRWFAAHRGLVMGILTASTATGT
FT                   LVFLPGLAAIAAAGGWQPVVLTVAGVIAALIPLVTWLLPERPADIGLLPYGAAPGAVVE
FT                   PLRRANPFRTAIEGLVRASRKSDFWLLFGTFYICGLTTNGLVGTHMISFCADMGLPEVR
FT                   AAGLLALMGIFDLIGTTGSGWLTDRYDPRKLLFVYYGLRGLSLMALPFTDFSFYSLSIF
FT                   AVFYGLDWIATVPPTVRLTNEVFGERDAPIVFGWIAAGHQAGAATAAFGAGLSRAVEGR
FT                   YLEAFLAAGLTGLVAAMMSLMIGRAARRAVATA"
     MSNAFAAGGA PPASRRPFGR NYAFVVVGVV FLALLAAAGL RAAPGVLILP LEQAFGWSRA        60
     TISFSAGLGI FLYGLVGPFA AALMQSFGIR RTLLCALALM AASTGLSAFM SEPWHLVATW       120
     GLLSGLGSGC VAIVLGATVV NRWFAAHRGL VMGILTASTA TGTLVFLPGL AAIAAAGGWQ       180
     PVVLTVAGVI AALIPLVTWL LPERPADIGL LPYGAAPGAV VEPLRRANPF RTAIEGLVRA       240
     SRKSDFWLLF GTFYICGLTT NGLVGTHMIS FCADMGLPEV RAAGLLALMG IFDLIGTTGS       300
     GWLTDRYDPR KLLFVYYGLR GLSLMALPFT DFSFYSLSIF AVFYGLDWIA TVPPTVRLTN       360
     EVFGERDAPI VFGWIAAGHQ AGAATAAFGA GLSRAVEGRY LEAFLAAGLT GLVAAMMSLM       420
     IGRAARRAVA TA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page