(data stored in ACNUC7421 zone)

EMBL: CP001349.PE298

CP001349.PE298       Location/Qualifiers
FT   CDS             346902..347462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0306"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2299
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55350"
FT                   /db_xref="GOA:B8IAV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55350.1"
FT                   /translation="MRAGDRIRAAARDLFYRRGIRAVGVEEIVERAGVTKPSLYRGFAS
FT                   KDALAVACLEDFAAAFQARLETALSAHPGDARAGLMAFLADLTDRTSRPGYRGCGLSNA
FT                   VIEHPEPDHPARRAALASKRVLRARLEEIARDLGAREPEGLADGLLLLIEGAFASGQIF
FT                   GPGGPARSLTRAAEALIAASRAA"
     MRAGDRIRAA ARDLFYRRGI RAVGVEEIVE RAGVTKPSLY RGFASKDALA VACLEDFAAA        60
     FQARLETALS AHPGDARAGL MAFLADLTDR TSRPGYRGCG LSNAVIEHPE PDHPARRAAL       120
     ASKRVLRARL EEIARDLGAR EPEGLADGLL LLIEGAFASG QIFGPGGPAR SLTRAAEALI       180
     AASRAA                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page