(data stored in ACNUC7421 zone)

EMBL: CP001349.PE299

CP001349.PE299       Location/Qualifiers
FT   CDS             347665..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55351"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV8"
FT                   /inference="similar to AA sequence:KEGG:M446_2298"
FT                   /protein_id="ACL55351.1"
FT                   /translation="MTLVRRFLVAPSLVRLIRKERGASRITEGYFQPQAGRTSFVRVDG
FT                   TQCHLVLMTTDEAGVSGEERTEVPRAHGDALLDVCAGKAAYDRTVIALGNGRDALVDRY
FT                   ATPGALDLISVAFAEADEASGFAPPAWFGPEVTADTAYLGSSIALQGTPQPGEVPLSNA
FT                   ALDAVLDLVEHRYGFGRYGAPRTDDANTVTNALRRLATRPPGEAAAAPASKPETQAGEE
FT                   PGDARIDDVIESLSQALGATVPGEGGREEGAAFERWTVRPRRTQPT"
     MTLVRRFLVA PSLVRLIRKE RGASRITEGY FQPQAGRTSF VRVDGTQCHL VLMTTDEAGV        60
     SGEERTEVPR AHGDALLDVC AGKAAYDRTV IALGNGRDAL VDRYATPGAL DLISVAFAEA       120
     DEASGFAPPA WFGPEVTADT AYLGSSIALQ GTPQPGEVPL SNAALDAVLD LVEHRYGFGR       180
     YGAPRTDDAN TVTNALRRLA TRPPGEAAAA PASKPETQAG EEPGDARIDD VIESLSQALG       240
     ATVPGEGGRE EGAAFERWTV RPRRTQPT                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page