(data stored in ACNUC7421 zone)

EMBL: CP001349.PE3

CP001349.PE3         Location/Qualifiers
FT   CDS             2901..4049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: met:M446_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55055"
FT                   /db_xref="GOA:B8ISZ3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL55055.1"
FT                   /translation="MAAPDPFRVTRLIARDFRNHASLDLGVSRPFVALVGENGAGKTNI
FT                   LEALSLFAPGRGLRRADFAAMAREGGPGGFAVSLNLAGPHGEHRVGTAWEPPQTREERA
FT                   GRLCRIDGASAPSPTAFAEHLRVVWLTPDLDALFRGPAGERRRFLDRLVLAVDAGHGAR
FT                   VSALERALRSRNRLLEERPDDTPWLDAVEREVAELAIAVALARRETVERLDRLILASRD
FT                   EASPFPWAGVRLEGEIDDLVAVWPAVDAEDRFRAMLRQNRFRDRAAGRTLAGPQASDLL
FT                   VRHGPKDVPAGTASTGEQKALLIGLVLAHARLVAGMSGLPPLVLLDEVAAHLDPRRRAG
FT                   LFDALEALPGQVWMTGADPALFAELGNRGDLIAVADGHLAPG"
     MAAPDPFRVT RLIARDFRNH ASLDLGVSRP FVALVGENGA GKTNILEALS LFAPGRGLRR        60
     ADFAAMAREG GPGGFAVSLN LAGPHGEHRV GTAWEPPQTR EERAGRLCRI DGASAPSPTA       120
     FAEHLRVVWL TPDLDALFRG PAGERRRFLD RLVLAVDAGH GARVSALERA LRSRNRLLEE       180
     RPDDTPWLDA VEREVAELAI AVALARRETV ERLDRLILAS RDEASPFPWA GVRLEGEIDD       240
     LVAVWPAVDA EDRFRAMLRQ NRFRDRAAGR TLAGPQASDL LVRHGPKDVP AGTASTGEQK       300
     ALLIGLVLAH ARLVAGMSGL PPLVLLDEVA AHLDPRRRAG LFDALEALPG QVWMTGADPA       360
     LFAELGNRGD LIAVADGHLA PG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page