(data stored in ACNUC7421 zone)

EMBL: CP001349.PE30

CP001349.PE30        Location/Qualifiers
FT   CDS             30342..31670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0031"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   SH3 type 3 domain protein; KEGG: met:M446_0029 peptidase
FT                   C14 caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55082"
FT                   /db_xref="GOA:B8IT20"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT20"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACL55082.1"
FT                   /translation="MPENRCPFLLDITPRQHPVALSGSCSRSLPEGEGLVRRVWLWLIL
FT                   WAAMVHEAAAANRLAFVVGVDTYPNLGPAAALERPVADARAVAETLEAIGFRVTLLSAA
FT                   VTQETFLRRFGAFADQVQPGDTALFYFAGHGIALQGTNYLLPSDIPAIEPGQELLARTR
FT                   ALAEADLSAALRERGARVVVMVIDACRDNPFPRAGTRSVGLSRGLARTEPAEGVFSLYA
FT                   AGAGQQALDRLPGRDPSPNSVFTRVFVAQLRRPGLNLIDLGETVRDEVVKLAETVPHKQ
FT                   VPAYYNEVRGARFISLAGAEAAPRPAVDPPPAAPRPAEAPGAATPPALPASVPPVPPAV
FT                   APSRPPATWPPSAPAAGEPLRDARIGLFSHPVRLDPGGDNWLALRSRPSASEGVRLMKL
FT                   GPDSLFTVLGRQGVWLNVRLRTGETGWVHGDYVGCCRRAPLLP"
     MPENRCPFLL DITPRQHPVA LSGSCSRSLP EGEGLVRRVW LWLILWAAMV HEAAAANRLA        60
     FVVGVDTYPN LGPAAALERP VADARAVAET LEAIGFRVTL LSAAVTQETF LRRFGAFADQ       120
     VQPGDTALFY FAGHGIALQG TNYLLPSDIP AIEPGQELLA RTRALAEADL SAALRERGAR       180
     VVVMVIDACR DNPFPRAGTR SVGLSRGLAR TEPAEGVFSL YAAGAGQQAL DRLPGRDPSP       240
     NSVFTRVFVA QLRRPGLNLI DLGETVRDEV VKLAETVPHK QVPAYYNEVR GARFISLAGA       300
     EAAPRPAVDP PPAAPRPAEA PGAATPPALP ASVPPVPPAV APSRPPATWP PSAPAAGEPL       360
     RDARIGLFSH PVRLDPGGDN WLALRSRPSA SEGVRLMKLG PDSLFTVLGR QGVWLNVRLR       420
     TGETGWVHGD YVGCCRRAPL LP                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page