(data stored in ACNUC7421 zone)

EMBL: CP001349.PE300

CP001349.PE300       Location/Qualifiers
FT   CDS             complement(349017..350351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0308"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55352"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL55352.1"
FT                   /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPDFR
FT                   TIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGRMKT
FT                   TEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKAALEA
FT                   EAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGFATEANL
FT                   TALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRYRLRKQVV
FT                   EPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     MAKVFRSWDV DQGWLLPPSL HEFVPPGHMA HFVRDTVREA LDLSAILDTY TEERGYPPYH        60
     PGMMVALLLY GYSRGLYSSR QLARACEERV DVMAVTGLNR PDFRTIAEFR KRHLAALSDL       120
     FVQVLRLCQA AGLVGFAHVA VDGTKLKANA SRHKAMSYGR MKTTEAALAA EVEAWLAQAA       180
     EMDAAEDRAH GMDRRGDETP DWMADKQRRL AAIRAAKAAL EAEAADPPAP EDESGPGASS       240
     GMRWQGRPLR GEDGGPPDRA QRNFTEPDSR ILPTRDGFVQ GYNGQIAVDA AHQVIVAQRL       300
     VTNAADYRAL VPLIDDVSAH LGRKPREVSG DAGFATEANL TALQARRIRG YLPPGRARHG       360
     EAHAAGRRKL TKMPLMSAMA QRLKRAGRRS RYRLRKQVVE PVFGQMKQAR GFRQFLLRGL       420
     EQVRGEWAMI CTAHNLLKLA QAAR                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page