(data stored in ACNUC7421 zone)

EMBL: CP001349.PE301

CP001349.PE301       Location/Qualifiers
FT   CDS             350731..352092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0309"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_2297 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55353"
FT                   /db_xref="GOA:B8IAW0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW0"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55353.1"
FT                   /translation="MQPTAAPTAAAPTAPAAPHHPWYRVLYIQVLIAIALGVLLGYLAP
FT                   DTAKSMKPLGDAFIALIKMMIAPIIFCTIVHGIASIGDLKKVGRVGLKALVYFEAVSTL
FT                   ALLVGVIVGELIRPGAGFGADPAKLDASAVAGYAQKAAGESTIGHLMAIIPKSFFDALA
FT                   TGDLLQVLLIAILTGVVVTGLGERAKGVTHAIDVAAEIFFRIIGMIVKLAPLGAFGAMA
FT                   FTIGQFGIGKLGNLAGLVATFYLTSLFFVLVVLGLIARFAGFSILKFLAYIKDELLIVL
FT                   GTSSSESVLPHMMQKMKRLGASDSVVGLVIPTGYSFNLDGTNIYMTLATLFLAQAVGAD
FT                   LSFGQYATIILVAMLTSKGASGVTGAGFVTLAATLAAIPGNPVPVAAMALILGVDKFMS
FT                   ECRALTNLVGNGVATIVVSRWEGELDPVKLREVMAHPVAIGTEISDETPEPITP"
     MQPTAAPTAA APTAPAAPHH PWYRVLYIQV LIAIALGVLL GYLAPDTAKS MKPLGDAFIA        60
     LIKMMIAPII FCTIVHGIAS IGDLKKVGRV GLKALVYFEA VSTLALLVGV IVGELIRPGA       120
     GFGADPAKLD ASAVAGYAQK AAGESTIGHL MAIIPKSFFD ALATGDLLQV LLIAILTGVV       180
     VTGLGERAKG VTHAIDVAAE IFFRIIGMIV KLAPLGAFGA MAFTIGQFGI GKLGNLAGLV       240
     ATFYLTSLFF VLVVLGLIAR FAGFSILKFL AYIKDELLIV LGTSSSESVL PHMMQKMKRL       300
     GASDSVVGLV IPTGYSFNLD GTNIYMTLAT LFLAQAVGAD LSFGQYATII LVAMLTSKGA       360
     SGVTGAGFVT LAATLAAIPG NPVPVAAMAL ILGVDKFMSE CRALTNLVGN GVATIVVSRW       420
     EGELDPVKLR EVMAHPVAIG TEISDETPEP ITP                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page