(data stored in ACNUC7421 zone)

EMBL: CP001349.PE302

CP001349.PE302       Location/Qualifiers
FT   CDS             352089..353012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0310"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: met:M446_2296 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55354"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACL55354.1"
FT                   /translation="MSTRPPLLIGLDVGGTKIAGIALGPDGRVLAERRAPTPRGDYEGS
FT                   LRAMTDLVAALEAAAGGTGTVGLGIPGAVSPATGLIKNANSTWLIGRPFKSDLEQRLGR
FT                   PVRIENDANCLAVSEAVDGAGAGASLVWAVILGTGVGSGIAVEARALSGRNRIAGEWGH
FT                   NPLPAPREDEHPGPPCYCGRRGCIEAWLSGPALTADHARVTGETLSGEAIVAAMRAGDA
FT                   VARATFARWRERLARSLASVINILDPDVIVLGGGLSTIDEVYPGLIEEAAPHVISDVVT
FT                   TPIVKSRYGDASGVRGAAWLWKDATD"
     MSTRPPLLIG LDVGGTKIAG IALGPDGRVL AERRAPTPRG DYEGSLRAMT DLVAALEAAA        60
     GGTGTVGLGI PGAVSPATGL IKNANSTWLI GRPFKSDLEQ RLGRPVRIEN DANCLAVSEA       120
     VDGAGAGASL VWAVILGTGV GSGIAVEARA LSGRNRIAGE WGHNPLPAPR EDEHPGPPCY       180
     CGRRGCIEAW LSGPALTADH ARVTGETLSG EAIVAAMRAG DAVARATFAR WRERLARSLA       240
     SVINILDPDV IVLGGGLSTI DEVYPGLIEE AAPHVISDVV TTPIVKSRYG DASGVRGAAW       300
     LWKDATD                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page